Recombinant Rhodobacter capsulatus Nitrogen fixation protein RnfF (rnfF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please specify it; we will prioritize its development.
Synonyms
rnfF; FAD:protein FMN transferase; Flavin transferase; Nitrogen fixation protein RnfF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-523
Protein Length
full length protein
Species
Rhodobacter capsulatus (Rhodopseudomonas capsulata)
Target Names
rnfF
Target Protein Sequence
MTGCCDDGPATGPRDLRERLRVVAVRGESLVVAADRASACAACAEAKGCGTRALMSMHRT DLMTIARPAGLIVAPGDEVEVAMSGNNLLAGAGLAYLLPALAFVVALALASGAGLSDGGA ALVGGVVLMFSFLPLVLLEAARGCRGRCRCSTCIRGTADDGRRAAFRTGLALAAGLVLAG GVRVLTAPAPDVSETFYVFGTLLEVETHGVPEAQARDAMAVLGAHFRQMHRDWHAWAPGE LESLNAAMAAGQSFEVDPGLAKLLQQGRDLACRSEGLFDPAVGGMVEAWGFHADTPPEAI RSDAVVAKLLAGAPKMTDLTITGTTVRSSNPAVQLDLGAYAKGAALDLAEADLTAAGIRD AVLNAGGGVQVLGDHGSRPWRVAIRDPFEWGVVGAVSLRPGEALHTSGNYERYFDRGGIR FSHIIDPRTARPMRGVVSVSVLSDNGALSDAAATALCVAGEEDWPRIAAQMGVRAVLRIT DDGSIFATPEMRARLEAVEGGFPAPITVVDLPKDVAIPLCPEG
Uniprot No.

Target Background

Function

Recombinant Rhodobacter capsulatus Nitrogen Fixation Protein RnfF (rnfF): A flavin transferase that catalyzes the transfer of the FMN moiety from FAD, covalently binding it to the hydroxyl group of a threonine residue in a target flavoprotein. It is likely involved in modifying RnfG and RnfD and is essential for nitrogen fixation.

Protein Families
RseC family; ApbE family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Rnf complex in Rhodobacter capsulatus and how does RnfF fit within this system?

The Rnf (Rhodobacter Nitrogen Fixation) complex in R. capsulatus is a membrane-bound electron transport system essential for nitrogen fixation. This complex is encoded by the rnfABCDGEH operon, comprising seven genes . The complex functions as a dedicated electron transport system to nitrogenase, the enzyme responsible for converting atmospheric nitrogen to ammonia .

RnfF is one of the proteins in this complex, functioning as a nitrogen fixation protein that contributes to the electron transport chain. The entire complex is thought to function as a novel energy-coupling oxidoreductase that facilitates electron flow to nitrogenase during nitrogen fixation .

How was the essential role of the Rnf complex in nitrogen fixation discovered?

The essential role of the Rnf complex in nitrogen fixation was elucidated through systematic mutagenesis studies. Researchers created various rnf mutants and observed their ability to grow diazotrophically (using atmospheric nitrogen). The results demonstrated that "no rnf mutants tested grew diazotrophically" under both light and dark conditions .

Additionally, complementation analysis with plasmids carrying the rnf operon confirmed the essential nature of these genes for nitrogen fixation. When the whole rnf operon was cloned under control of the nifH promoter in plasmid pNR117 and expressed in rnf mutants, functional complementation occurred, restoring nitrogen fixation capability .

How does the Rnf complex contribute to electron transport in nitrogen fixation?

The Rnf complex plays a crucial role in transferring electrons to nitrogenase during nitrogen fixation. Research has demonstrated that the supply of reductants through the Rnf complex might be rate-limiting for nitrogenase activity in vivo . When the rnf operon was overexpressed, strains displayed nitrogenase activities 50-100% higher than wild-type levels, correlating with increased production of Rnf polypeptides .

Comparative analysis revealed that four Rnf gene products are similar in sequence to components of an Na⁺-dependent NADH:ubiquinone oxidoreductase from Vibrio alginolyticus , suggesting the Rnf complex may function as an energy-coupling oxidoreductase. This complex facilitates electron flow from NADH (or another electron donor) to ferredoxins (such as FdxN), which then transfer electrons to nitrogenase .

What expression systems are most effective for producing recombinant RnfF protein?

For optimal expression of RnfF in E. coli, researchers should consider:

  • Using BL21(DE3) or similar strains optimized for protein expression

  • Employing tightly regulated promoters (such as T7)

  • Optimizing growth conditions (temperature, induction timing, media composition)

  • Adding stabilizing agents if necessary

What purification strategies yield the highest purity and stability of recombinant RnfF?

Purification of His-tagged recombinant RnfF typically achieves purity greater than 90% as determined by SDS-PAGE . While specific purification methods aren't explicitly detailed in the literature, the following protocol would be effective based on the protein's properties:

  • Cell lysis under reducing conditions to prevent oxidation of potential iron-sulfur clusters

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size-exclusion chromatography to remove aggregates

  • Storage as lyophilized powder or in buffer with 5-50% glycerol

For storage, it's recommended to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week, while long-term storage requires reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (default 50%) and storage at -20°C/-80°C .

How can researchers assess the functional activity of recombinant RnfF in vitro?

Assessment of RnfF functional activity can be approached through several complementary methods:

  • Electron transfer assays: Measuring electron transfer rates using artificial electron acceptors and spectrophotometric detection of reduction.

  • Nitrogenase activity assays: Similar to studies of the entire Rnf complex, where researchers observed "in vitro nitrogenase assays performed in the presence of an artificial electron donor indicated that the catalytic activity of the enzyme was not increased in strains overproducing the Rnf polypeptides" . A comparative approach could determine RnfF's contribution.

  • Reconstitution experiments: Incorporating purified RnfF into liposomes along with other Rnf components to reconstruct the electron transport pathway.

  • Coupled enzyme assays: Measuring the ability of RnfF to facilitate electron transfer in a system containing other components of the nitrogen fixation pathway.

What techniques are most effective for studying RnfF interactions with other Rnf complex components?

Several techniques have proven effective for investigating protein-protein interactions within the Rnf complex:

  • Immunoprecipitation: Experiments performed on solubilized membrane proteins revealed that RnfB and RnfC associate with each other and with additional polypeptides that may be components of the membrane-bound complex .

  • Complementation analysis: Strains carrying plasmids expressing the rnf operon can be analyzed to determine if functional biosynthesis of a competent complex occurs .

  • Stability analysis in mutants: The observation that "RnfB and RnfC proteins were absent in mutant strains bearing insertions at various positions within the rnfABCDGEH operon, suggesting that their stability depends on the cosynthesis of the other rnf gene products" demonstrates the effectiveness of this approach.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify interaction sites between complex components.

How does the electron transport pathway involving RnfF differ between photosynthetic and respiratory growth conditions?

The Rnf complex plays an essential role in nitrogen fixation under both photosynthetic (light) and respiratory (dark) conditions in R. capsulatus. Research has demonstrated that "no rnf mutants tested grew diazotrophically, and a nonpolar fdxN-null mutant showed decreased diazotrophic growth in the dark, suggesting that the Rnf and FdxN proteins form the primary electron donor pathway to nitrogenase in the dark as well as in the light" .

Importantly, nonphotosynthetic mutants lacking components of cyclic electron transport grew diazotrophically, and the levels of Rnf proteins were similar to those of the wild-type . This indicates that the rnf gene products play an essential role in nitrogen fixation without any functional link to the cyclic electron transport system used in photosynthesis.

This research suggests the Rnf complex functions as a versatile electron transport system capable of accepting electrons from different sources depending on the growth conditions (photosynthetic or respiratory), but consistently delivering electrons to nitrogenase through similar pathways.

What is the relationship between ferredoxins and the Rnf complex in electron transfer to nitrogenase?

The relationship between ferredoxins and the Rnf complex is critical for nitrogen fixation. Recent research has identified two distinct ferredoxins, FdxC and FdxN, as essential for nitrogen fixation by the iron nitrogenase in R. capsulatus .

Proteome analyses revealed upregulation of four ferredoxins under nitrogen-fixing conditions reliant on Fe-nitrogenase compared to non-nitrogen-fixing conditions. Deletion studies showed that only deletions of fdxC or fdxN resulted in slower growth and reduced Fe-nitrogenase activity, while double deletion of both fdxC and fdxN abolished diazotrophic growth completely .

The Rnf complex appears to function upstream of these ferredoxins in the electron transport chain, potentially transferring electrons from NADH to ferredoxins, which then directly reduce nitrogenase. This is supported by the observation that "a nonpolar fdxN-null mutant showed decreased diazotrophic growth in the dark, suggesting that the Rnf and FdxN proteins form the primary electron donor pathway to nitrogenase" .

How does the electron transport system involving RnfF in R. capsulatus compare to those in other diazotrophs?

The electron transport systems for nitrogen fixation vary among different diazotrophic bacteria:

OrganismNitrogenase TypesElectron Transport ComponentsKey Differences
R. capsulatusMo- and Fe-nitrogenasesRnf complex, FdxC, FdxNEssential role of Rnf complex, two critical ferredoxins
Azotobacter vinelandiiMo-, V-, and Fe-nitrogenasesFix complex, ferredoxinsMore diverse nitrogenase systems
Rhodopseudomonas palustrisMo-, V-, and Fe-nitrogenasesVarious ferredoxinsContains all three nitrogenase isoforms
Sinorhizobium melilotiMo-nitrogenaseFdxNHigh similarity of FdxN to R. capsulatus FdxN

R. capsulatus provides a more robust expression system for studying Fe-nitrogenase compared to organisms with all three nitrogenase isoforms . The essential nature of the Rnf complex for nitrogen fixation appears to be a distinctive feature of R. capsulatus, though homologous genes exist in other bacteria .

What evolutionary relationships exist between the Rnf complex and other bacterial electron transport systems?

The Rnf complex shows significant evolutionary relationships with other bacterial electron transport systems:

  • Na⁺-dependent NADH:ubiquinone oxidoreductases: Four Rnf gene products show sequence similarity to components of this complex from Vibrio alginolyticus. Specifically, RnfA, RnfD, and RnfE have "striking similarities with membrane components" of this oxidoreductase .

  • Homologous genes in non-diazotrophs: Genes homologous to the rnf genes have been identified in the genomes of nondiazotrophic bacteria, including Haemophilus influenzae and Escherichia coli , suggesting these systems may serve different functions in different organisms.

  • Complex I of respiratory chains: RnfC has potential binding sites for NADH and flavin mononucleotide and resembles the NADH-binding subunit of complex I of the respiratory chain .

These relationships suggest the Rnf complex is part of a broader family of energy-coupling oxidoreductases that may have evolved to perform specialized functions in nitrogen fixation while retaining structural similarities to more widespread electron transport systems.

How can researchers address stability issues with recombinant RnfF protein?

Recombinant RnfF protein, like many electron transport proteins, presents several stability challenges. Researchers can address these issues through the following approaches:

  • Storage optimization:

    • Store as lyophilized powder when possible

    • Avoid repeated freeze-thaw cycles

    • Keep working aliquots at 4°C for up to one week only

    • For long-term storage, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (recommended 50%) before storing at -20°C/-80°C

  • Buffer composition:

    • Include reducing agents (DTT or β-mercaptoethanol) to prevent oxidation

    • Optimize pH based on protein stability studies

    • Consider adding stabilizing agents such as trehalose (which is used in the storage buffer )

  • Handling procedures:

    • Work quickly and keep samples on ice

    • Minimize exposure to oxygen when handling proteins with potential iron-sulfur clusters

    • Consider using an anaerobic chamber for critical experiments

What strategies can overcome challenges in expressing membrane-associated components of the Rnf complex?

Expression of membrane-associated components of the Rnf complex presents significant challenges. Research has shown that while some Rnf proteins were successfully expressed in E. coli, "the products of rnfA, rnfD and rnfE, predicted to be transmembrane proteins, could not be stably maintained in E. coli" . The following strategies can help overcome these challenges:

  • Alternative expression systems:

    • Consider specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

    • Explore eukaryotic systems for complex membrane proteins

  • Fusion tags and partners:

    • Use solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Consider specialized membrane protein fusion tags

  • Expression conditions:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Extend expression time

  • Co-expression approaches:

    • Co-express with chaperones

    • Express multiple components simultaneously, as "their stability depends on the cosynthesis of the other rnf gene products"

  • Iron availability:

    • Monitor and adjust iron concentration in growth media, as "iron limitation during growth resulted in a decrease both in the cellular content of RnfB and in the level of transcription of the rnfABCDGEH operon"

By implementing these approaches, researchers can improve the likelihood of successfully expressing and studying membrane-associated components of the Rnf complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.