Recombinant Rhodobacter capsulatus Probable Ni/Fe-hydrogenase B-type cytochrome subunit (hupC)

Shipped with Ice Packs
In Stock

Description

Genetic Organization and Regulation

The hupABC operon includes hupA (small subunit), hupB (large subunit), and hupC (cytochrome subunit). Genetic studies reveal:

  • Transcriptional Control:

    • H₂ Sensing: The hupUV genes encode a cytosolic H₂ sensor that interacts with the two-component system (HupT kinase, HupR response regulator) .

    • Regulation: In the absence of H₂, HupT phosphorylates HupR, inhibiting hupABC transcription. H₂ binding to HupUV releases HupT, allowing HupR dephosphorylation and promoter activation .

  • Operon Structure: hupC is contiguous with hupS and hupL (renamed hupA and hupB), forming a single transcription unit (hupSLM) .

Key Findings from Mutagenesis:

  • hupM mutants (BCX1, BCX2) lacking hupC exhibited inactive hydrogenase, unable to grow autotrophically or recycle electrons .

  • Plasmid-based hupSLM restoration (pBC8) rescued functionality, confirming hupC’s necessity for membrane localization .

Functional Role in Hydrogen Metabolism

The hupC-associated uptake hydrogenase catalyzes the reversible reaction:
2H++2eH22\text{H}^+ + 2\text{e}^- \leftrightarrow \text{H}_2

  • Physiological Relevance:

    • Electron Recycling: Facilitates proton reduction in nitrogenase-catalyzed N₂ fixation, optimizing energy efficiency .

    • H₂ Uptake: Prevents H₂ accumulation under autotrophic growth conditions, supporting anaerobic respiration .

H₂ Sensing and Localization:

  • HupUV vs. HupSL: HupUV (cytosolic) and HupSL (periplasmic) exhibit distinct H-D exchange kinetics. HupSL activity is pH-sensitive, while HupUV remains pH-insensitive .

  • Electron Transfer Pathway: hupC bridges the hydrogenase (hupAB) to the membrane, enabling electron flow to quinones or cytochrome bc₁ complexes .

Recombinant Production and Biotechnological Applications

Recombinant hupC is leveraged in:

  • Structural Studies: His-tagged hupC enables crystallography or NMR to elucidate cytochrome b’s role in electron transfer .

  • Biohydrogen Production: Engineering R. capsulatus strains with optimized hupC expression could enhance H₂ yield in phototrophic systems .

  • Redox Balance: hupC’s role in stabilizing the uptake hydrogenase supports strain engineering for terpenoid biosynthesis, as seen in patchoulol production .

Research Significance and Future Directions

hupC remains a focal point for understanding hydrogenase assembly and regulation. Key areas include:

  • Biotechnological Engineering: Integrating hupC into synthetic pathways for biofuel or chemical production .

  • Mechanistic Studies: Investigating heme coordination and electron transfer dynamics using recombinant hupC .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
hupC; hupM; Probable Ni/Fe-hydrogenase B-type cytochrome subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Rhodobacter capsulatus (Rhodopseudomonas capsulata)
Target Names
hupC
Target Protein Sequence
MKGVSDERINAPVRGPDEIFEASRLTGDATREDLESIRRRTSVYVYEAPVRVWHWVNALA ITILVVTGYFIASPLPSMQIGEATDQFVMGYIRFAHFAAGVVMSVAFFGRIYWAFVGNRH AWQMFYIPIFNKRYWKEFVFELRWYFFLEEEPKKYIGHNPLAHAAMFTFITLGITFMMIT GWALYAEGAGQGGVTDSLFGWVLGYVQNSQRLHTLHHLGMWAIVIFAIIHIYAAVREDVM SRQSMVSTMISGHRTFKDDRIE
Uniprot No.

Target Background

Function

Probable b-type cytochrome.

Protein Families
HupC/HyaC/HydC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the hupC gene and what role does it play in Rhodobacter capsulatus?

The hupC gene is part of the hupSLC operon in Rhodobacter capsulatus, which encodes an energy-generating [NiFe]hydrogenase. While hupS and hupL encode the small and large subunits of the hydrogenase enzyme respectively, hupC specifically codes for an electron acceptor that functions as a membrane-integral cytochrome b . This cytochrome component plays a critical role in the electron transport chain, facilitating the transfer of electrons from hydrogen oxidation to cellular respiration processes. The complete hupSLC operon is positioned downstream from the hupTUV operon in the chromosome of R. capsulatus . The hydrogenase activity enabled by this genetic system allows the bacterium to grow under both chemoautotrophic and photoautotrophic conditions, demonstrating its metabolic versatility .

How is the expression of hupC regulated in R. capsulatus?

The regulation of hupC expression involves a sophisticated cascade system responding to hydrogen availability. The expression of the hupSLC operon, which includes hupC, is primarily activated by HupR, a response regulator belonging to the family of two-component regulatory systems. HupR functions as an essential activator for hydrogenase gene expression, as evidenced by the complete absence of hydrogenase activity in hupR mutants, even in the presence of hydrogen . HupR directly controls hupSL transcription by binding to a specific palindromic sequence (TTG-N5-CAA) centered at -152 nucleotides upstream from the transcriptional start site .

Additionally, negative regulation is provided by the hupTUV operon. The proteins HupU and HupV participate in negative regulation of hydrogenase expression in concert with HupT, a sensor histidine kinase involved in the repression process . Inactivation studies have shown that mutants lacking functional HupV or both HupU and HupV demonstrate derepressed hydrogenase synthesis, particularly under oxygenic conditions .

What are the structural characteristics of HupC compared to other cytochrome subunits?

The HupC protein in R. capsulatus functions as a membrane-integral cytochrome b that acts as an electron acceptor in the hydrogenase system . While the search results don't provide detailed structural information specifically about HupC, we can infer from related cytochrome b proteins that it likely contains multiple transmembrane helices with heme groups coordinated between them for electron transfer.

For comparison, other proteins in the R. capsulatus hydrogenase system show interesting structural features. The HupS (small subunit) and HupL (large subunit) proteins have homologs in other bacterial species. The regulatory proteins HupU and HupV show 25% and 28% identity with HupS and HupL respectively, suggesting evolutionary relationships despite different functions . HupU lacks the signal peptide present in HupS, and HupV lacks the C-terminal sequence of HupL, both of which are normally cleaved during hydrogenase processing .

What methods are most effective for expressing recombinant hupC in heterologous systems?

When expressing recombinant hupC in heterologous systems, researchers should consider several methodological approaches based on established protocols for membrane proteins from R. capsulatus:

  • Promoter selection: The native promoter of hupC might not function optimally in heterologous hosts. Based on successful expression strategies for other R. capsulatus genes, the nitrogenase promoter (pnifHDK) can be an effective alternative. This approach involves PCR amplification of the promoter region (approximately 330 bp) with primers containing appropriate restriction sites (e.g., HindIII and NcoI) for subsequent cloning .

  • Vector construction: For efficient expression, the gene can be cloned into vectors that function in both E. coli and R. capsulatus, such as derivatives of pPHU231 . This allows for easy manipulation in E. coli and subsequent expression in a photosynthetic bacterial host more similar to the native environment.

  • Growth conditions: When expressing membrane proteins like HupC, culture conditions significantly impact proper folding and membrane insertion. For optimal results, heterologous hosts should be grown under low-oxygen conditions (80% full flasks agitated at 150 rpm) to mimic the microaerobic environment preferred by R. capsulatus .

  • Protein extraction: Since HupC is a membrane protein, gentle extraction methods using mild detergents are recommended to maintain the protein's native conformation and functionality.

What analytical techniques are most suitable for characterizing hupC interactions with electron transport chain components?

Characterizing the interactions between HupC and other electron transport chain components requires specialized techniques that preserve these often transient interactions:

  • Co-immunoprecipitation assays: Using antibodies specific to HupC or potential interaction partners can help isolate protein complexes from R. capsulatus membranes. This technique is particularly valuable for identifying previously unknown interaction partners.

  • Fluorescence reporter systems: The direct fluorescence reporter system using mCherry, as described for studying RcGTA expression in R. capsulatus , can be adapted to study hupC expression and interactions. This approach allows visualization of protein expression and localization in live cells without the need for cell permeabilization.

  • Mutagenesis studies: Systematic mutation of potential interaction sites in HupC, followed by activity assays, can reveal residues critical for electron transfer. This approach has been successfully used in studies of the regulatory system involving HupT, HupU, and HupV proteins .

  • Electron paramagnetic resonance (EPR) spectroscopy: This technique is particularly suited for studying electron transfer proteins like cytochromes and can provide information about the redox states and electronic structure of the heme groups in HupC during interaction with electron transport chain components.

How can directed evolution approaches be applied to enhance hupC functionality?

Directed evolution represents a powerful approach to enhance hupC functionality, particularly for improving hydrogen metabolism. Based on successful strategies applied to R. capsulatus:

  • Random mutagenesis coupled with selection: UV mutagenesis can be applied to R. capsulatus strains containing fluorescent reporter constructs linked to hydrogen production. Fluorescence-activated cell sorting (FACS) can then be used to isolate mutants with enhanced performance . This approach has achieved 2-3 fold increases in hydrogen production in previous studies.

  • Screening methodology: After mutagenesis, cells can be processed for FACS by:

    • Centrifugation at 4,500×g for 15 minutes at 4°C

    • Resuspension in PBS with 10% glycerol

    • Incubation with appropriate fluorescent substrates

    • Analysis and sorting based on fluorescence intensity

  • Validation of mutants: Enhanced variants should be verified through:

    • Enzyme activity assays measuring hydrogen uptake or production

    • Western blot analysis to confirm protein expression levels

    • Growth assays under various conditions to assess physiological impacts

    • Genetic sequencing to identify beneficial mutations

  • Protein engineering considerations: When applying directed evolution to hupC specifically, researchers should focus on mutations affecting:

    • Membrane integration efficiency

    • Heme coordination and redox properties

    • Interaction surfaces with HupS and HupL

    • Stability under varying oxygen concentrations

How does oxygen affect the expression and activity of the hydrogenase system including hupC?

Oxygen plays a critical regulatory role in R. capsulatus hydrogenase expression and activity, with significant implications for hupC:

  • Regulatory effects: The hupTUV system functions as a negative regulator of hydrogenase expression, particularly under oxygenic conditions. Studies have shown that HupV- and Hup(UV)- mutants exhibit derepressed hydrogenase synthesis, especially in the presence of oxygen . This suggests that the natural regulation system suppresses hydrogenase expression when oxygen is present.

  • Experimental considerations: When designing experiments to study hupC under different oxygen conditions, researchers should use:

    • Controlled growth environments with defined oxygen levels

    • Sealed vessels for anaerobic (photosynthetic) growth with incandescent lamp illumination (~100 μM·m-2·s-1) for oxygen-free conditions

    • 80% full flasks agitated at 150 rpm to achieve low-aeration conditions

    • Complete growth media appropriate for the intended conditions (e.g., RCV medium with 30 mM DL-malate and appropriate nitrogen sources)

  • Protective mechanisms: The oxygen sensitivity of [NiFe]hydrogenases necessitates protective mechanisms when expressed under aerobic conditions. Understanding how hupC contributes to these protective mechanisms represents an important research area.

What are the key considerations for designing experiments to study hupC regulation in vivo?

When designing in vivo experiments to study hupC regulation, several methodological considerations are essential:

  • Reporter system selection: Direct fluorescence reporter constructs using mCherry fused to the relevant promoter allow real-time monitoring of gene expression in live cells . This approach provides advantages over traditional lacZ reporter systems that require cell permeabilization.

  • Growth phase considerations: Expression of hydrogenase genes in R. capsulatus varies with growth phase. Studies have shown differential expression patterns between exponential and stationary phases, with important implications for experimental timing .

  • Single-cell analysis: Population heterogeneity is a significant factor in R. capsulatus gene expression. Flow cytometry analysis has revealed that gene expression in wild-type R. capsulatus often originates from small, distinct subsets of the population . This heterogeneity must be accounted for when analyzing experimental results.

  • Medium formulation: The precise composition of growth medium significantly impacts hydrogenase expression. For nitrogenase derepression, ammonium should be omitted from RCV medium (RCV 0), and in some cases, supplementation with 10 mM L-serine (RCVS) may be appropriate .

What are the current challenges in purifying functional recombinant hupC protein?

Purification of functional membrane proteins like hupC presents several significant challenges:

  • Membrane extraction: As an integral membrane protein, hupC requires careful extraction with detergents that maintain protein structure and function. Optimization of detergent type, concentration, and extraction conditions represents a major challenge.

  • Maintaining native conformation: The cytochrome nature of hupC means that proper heme incorporation and folding are essential for function. Purification protocols must preserve these critical structural elements.

  • Expression system selection: While E. coli is commonly used for recombinant protein expression, it may not provide the appropriate machinery for correct folding and post-translational modification of R. capsulatus proteins. Alternative expression hosts more closely related to R. capsulatus might be considered.

  • Protein stability: Once extracted from the membrane environment, hupC may exhibit limited stability. Researchers should develop rapid purification protocols and identify stabilizing buffer conditions.

How can gene transfer agents be utilized for genetic manipulation of hupC?

The gene transfer agent (RcGTA) of R. capsulatus provides a unique tool for genetic manipulation that could be applied to hupC research:

  • RcGTA overview: RcGTA is a bacteriophage-related genetic element that mediates lateral transfer of essentially random host DNA . It represents a potentially important mechanism of genetic exchange and microbial evolution.

  • Experimental applications: RcGTA can be used to transfer genetic modifications of hupC between R. capsulatus strains. This approach offers advantages for strains that might be recalcitrant to traditional transformation methods.

  • Methodological considerations:

    • RcGTA production is heterogeneous in populations, with a small subset of cells producing the majority of RcGTA particles in wild-type strains

    • Overproducer strains like DE442 show increased RcGTA production (up to 1000-fold greater than strain SB1003)

    • RcGTA release appears to occur through host cell lysis

  • Experimental protocol elements:

    • Selection of appropriate donor and recipient strains

    • Culture under conditions that promote RcGTA production

    • Filtration to obtain RcGTA-containing supernatant

    • Incubation of recipient cells with RcGTA preparation

    • Selection for successful gene transfer events

How does research on hupC contribute to understanding broader bacterial energy metabolism pathways?

Research on the hupC subunit provides valuable insights into several areas of bacterial energy metabolism:

  • Electron transport diversity: As a membrane-integral cytochrome b component, hupC exemplifies how bacteria have evolved diverse mechanisms for coupling substrate oxidation to energy conservation. Understanding its function contributes to our knowledge of the remarkable diversity in bacterial electron transport chains.

  • Hydrogen metabolism: The hydrogen uptake system in R. capsulatus, including hupC, represents an important model for studying how bacteria can utilize hydrogen as an energy source. This has implications for understanding microbial communities in diverse environments where hydrogen serves as an important intermediate.

  • Regulatory networks: The complex regulation of the hupSLC operon, involving both positive regulation by HupR and negative regulation by the hupTUV system , provides insights into how bacteria integrate multiple environmental signals to control metabolism.

  • Photosynthetic-heterotrophic flexibility: R. capsulatus can grow under both photosynthetic and heterotrophic conditions, with hydrogenase activity supporting this metabolic flexibility . Research on hupC contributes to understanding how bacteria coordinate different energy-generating pathways.

What are the most promising future directions for hupC research?

Based on current knowledge and technological capabilities, several promising research directions emerge:

  • Structure-function relationships: Determining the high-resolution structure of hupC and its interactions with other hydrogenase components would significantly advance understanding of its mechanism.

  • Synthetic biology applications: Engineered expression of optimized hupC variants could contribute to biotechnological applications in hydrogen production or utilization.

  • Ecological significance: Investigating the role of hupC-containing hydrogenases in natural microbial communities could reveal important insights about hydrogen cycling in various ecosystems.

  • Comparative studies: Examining homologous systems across diverse bacterial species would enhance understanding of the evolution and adaptation of hydrogen metabolism pathways.

  • Integration with emerging technologies: Combining hupC research with advanced techniques like single-cell RNA sequencing or in situ structural studies could reveal previously unrecognized aspects of its function and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.