Recombinant Rhodobacter capsulatus Reaction center protein H chain (puhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
puhA; Reaction center protein H chain; Photosynthetic reaction center H subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Rhodobacter capsulatus (Rhodopseudomonas capsulata)
Target Names
puhA
Target Protein Sequence
MVGVNFFGDFDLASLAIWSFWAFLAYLIYYLQTENMREGYPLENDDGKLSPNQGPFPVPS PKTFDLADGRKIVVPSVENEEAHRRTDLALERTSVNEGYPFRPTGNPMLDGVGPASWVPR RDEPEVDAHGHNKIQPMRKTEMKVSAGRDPRGMPVQAGDTEVVGKIVDMWVDIPEQLVRY LEVELNSGKKKLLPMTMLKIWSDRVRVNAITSDLFDTIPDIKSPDVVTKLEEDKISAYVA GGYMYAKGVKPYAL
Uniprot No.

Target Background

Function
The reaction center is a membrane-bound complex that initiates the photochemical reactions in the photosynthetic electron transfer process.
Protein Families
Reaction center PuhA family
Subcellular Location
Cellular chromatophore membrane; Single-pass membrane protein.

Q&A

What is the function of the puhA gene in Rhodobacter capsulatus?

The puhA gene in Rhodobacter capsulatus encodes the H subunit of the photosynthetic reaction center complex. This protein plays a critical role in the assembly and stability of both the reaction center (RC) and light-harvesting 1 (LH1) complexes, which are essential components of the photosynthetic apparatus. Research has demonstrated that mutant strains with either nonpolar or polar mutations in the puhA gene are incapable of photosynthetic growth and show significant deficiencies in both RC and LH1 complexes . The H subunit specifically functions as a structural protein that anchors the photosynthetic reaction center to the membrane and contributes to the proper assembly of the photosynthetic machinery.

How can I verify the successful mutation of the puhA gene?

Verification of successful puhA gene mutation can be performed through multiple complementary approaches. First, PCR amplification followed by restriction enzyme analysis or direct sequencing can confirm the presence of the intended genetic modification. Second, functional analysis through assessment of photosynthetic growth capabilities provides a phenotypic verification, as puhA mutants are characteristically unable to grow under photosynthetic conditions . Third, spectroscopic analysis of membrane preparations should show altered absorption profiles due to the absence of properly assembled RC and LH1 complexes. Finally, complementation studies using plasmids containing the wild-type puhA gene should restore the photosynthetic phenotype in nonpolar mutants, providing definitive confirmation of the mutation's specificity .

What expression systems are most effective for producing recombinant R. capsulatus proteins?

Based on research with similar R. capsulatus proteins, Escherichia coli provides an efficient heterologous expression system. For example, an efficient system for the recombinant expression of R. capsulatus xanthine dehydrogenase in E. coli has been successfully developed . For puhA expression, consider using E. coli strains optimized for membrane protein production, such as C41(DE3) or C43(DE3). The expression construct should include appropriate regulatory elements, such as the T7 promoter system, and may benefit from the addition of fusion tags (His6, MBP, etc.) to facilitate purification. Codon optimization may also improve expression levels, especially for genes with rare codons. Expression conditions require careful optimization, including temperature (typically lower temperatures of 16-25°C), inducer concentration, and duration to maximize protein yield while minimizing aggregation.

How should I design experiments to study puhA gene function using mutagenesis approaches?

When designing mutagenesis experiments for the puhA gene, consider both polar and nonpolar mutation strategies to distinguish between direct effects and downstream consequences. For nonpolar mutations, create in-frame deletions that maintain the reading frame of downstream genes while disrupting puhA function . For polar mutations, insert antibiotic resistance cartridges that terminate transcription and translation of downstream genes .

Include complementation controls with plasmids carrying the wild-type puhA gene to verify that observed phenotypes are specifically due to the puhA mutation. Design your experimental workflow following this sequence:

  • Generate mutant constructs (both polar and nonpolar)

  • Transform into R. capsulatus

  • Screen transformants for antibiotic resistance

  • Verify mutations by PCR and sequencing

  • Assess photosynthetic growth capabilities

  • Analyze spectroscopic properties of membrane preparations

  • Perform complementation studies with wild-type gene

  • Analyze protein composition of chromatophore membranes

Each step should include appropriate controls, and multiple independent mutants should be analyzed to ensure reproducibility .

What experimental approaches help distinguish between direct and pleiotropic effects of puhA mutations?

Distinguishing between direct and pleiotropic effects of puhA mutations requires multiple experimental approaches:

  • Compare nonpolar (in-frame) versus polar mutations: Nonpolar mutations affect only the puhA gene, while polar mutations disrupt both puhA and downstream genes. Differences between these mutants can reveal the specific role of puhA versus downstream effects .

  • Complementation analysis: Reintroducing the wild-type puhA gene should restore phenotypes directly caused by puhA mutation. Phenotypes that aren't restored likely result from other genetic changes or secondary effects .

  • Time-course studies: Analyze the temporal sequence of phenotypic changes following inducible gene inactivation to determine primary versus secondary effects.

  • Quantitative protein analysis: Using techniques like mass spectrometry to quantify changes in multiple proteins can reveal the cascade of effects following puhA mutation.

  • Epistasis analysis: Introducing mutations in genes suspected to be in the same pathway can help establish the sequence of gene action and identify direct versus indirect effects.

This approach allows researchers to create a causal map distinguishing primary consequences of puhA absence from secondary adaptations or pleiotropic effects .

How can I optimize subsampling strategies for large-scale data analysis in photosynthetic protein research?

When dealing with large datasets in photosynthetic protein research, principled design approaches for subsampling can significantly improve computational efficiency while maintaining statistical power. Rather than random sampling, consider utility-based experimental design approaches that maximize information content in your subsample.

For optimal subsampling:

  • Define clear research objectives and corresponding utility functions (e.g., parameter estimation precision for structural models).

  • Implement sequential design algorithms that iteratively select data points that maximize expected information gain.

  • Consider the covariance structure of your data - positive correlations between variables may require larger random samples to achieve the same utility as designed subsamples .

  • Evaluate the coverage of your design space - ensure your subsampled data adequately represents the corners of your parameter space, which can be challenging with correlated variables .

Data visualization comparing your actual selected data against optimal design points can serve as a diagnostic tool to evaluate subsampling quality .

How do mutations in puhA affect photosynthetic complex assembly?

Mutations in the puhA gene have profound effects on photosynthetic complex assembly in Rhodobacter capsulatus. Both polar and nonpolar puhA mutants are incapable of photosynthetic growth, indicating the essential nature of this gene for photosynthesis . Spectroscopic analysis of these mutants reveals deficiencies in both reaction center (RC) and light-harvesting 1 (LH1) complexes .

The H subunit encoded by puhA appears to play a crucial structural role in the assembly pathway. Without this protein, neither RCs nor LH1 complexes can properly assemble in the membrane. This suggests the H subunit may serve as a nucleation point or stabilizing factor required for the initial assembly steps of these complexes. Alternatively, it may facilitate proper membrane integration of other subunits.

Interestingly, complementation studies demonstrate that nonpolar puhA deletion strains can be restored to the parental phenotype with a plasmid containing the puhA gene, whereas polar puhA mutants cannot . This indicates that proper expression of downstream genes is also important for photosynthetic complex assembly, suggesting a coordinated assembly pathway involving multiple gene products in this region.

What structural features of the puhA gene product are essential for function?

While the search results don't provide specific structural data for the puhA gene product, we can infer essential structural features based on related research. The H subunit encoded by puhA typically contains:

  • Membrane-spanning domains that anchor the reaction center complex in the photosynthetic membrane

  • Interaction surfaces that facilitate binding to other reaction center subunits

  • Structural elements that contribute to the proper three-dimensional organization of the complex

Research approaches to identify essential structural features would include:

  • Site-directed mutagenesis targeting conserved amino acid residues

  • Construction of chimeric proteins with H subunits from related species

  • Truncation analysis to identify minimal functional domains

  • Crystallographic or cryo-EM studies of the intact reaction center

Functional assessment would require complementation testing of mutants, with successful restoration of photosynthetic growth indicating retention of essential structural features. Spectroscopic analysis would provide additional information about the integrity of the assembled complexes.

How do heterologous expression conditions affect the folding and activity of recombinant puhA protein?

The folding and activity of recombinant membrane proteins like the puhA gene product can be significantly affected by heterologous expression conditions. Based on experience with similar R. capsulatus proteins, several factors require careful optimization:

  • Expression temperature: Lower temperatures (16-25°C) typically promote proper folding by slowing protein production and allowing more time for membrane insertion.

  • Inducer concentration: Excessive expression can overwhelm the membrane insertion machinery, leading to protein aggregation. Titrating inducer concentrations can identify optimal expression levels.

  • Host strain selection: Specialized E. coli strains like C41(DE3) or Lemo21(DE3) contain adaptations for membrane protein overexpression.

  • Membrane composition: The phospholipid composition of E. coli differs from R. capsulatus, potentially affecting protein folding and function. Supplementation with specific lipids or co-expression of R. capsulatus chaperones may improve folding.

  • Fusion partners: N-terminal fusions with soluble proteins can enhance membrane protein expression and folding.

Similar to the approach used for R. capsulatus XDH , spectroscopic analysis and functional assays are essential to verify proper folding. Improperly folded membrane proteins typically aggregate, showing altered migration patterns on native gels and abnormal spectroscopic properties.

What spectroscopic methods are most informative for studying puhA-encoded protein function?

Several spectroscopic methods provide valuable information about puhA-encoded protein function and its role in photosynthetic complexes:

  • Absorption Spectroscopy: Measures the characteristic absorption bands of photosynthetic pigments associated with reaction centers and light-harvesting complexes. Wild-type R. capsulatus shows distinctive peaks at approximately 800 and 850-875 nm due to bacteriochlorophyll in properly assembled complexes, while puhA mutants show altered absorption profiles .

  • Circular Dichroism (CD): Provides information about protein secondary structure and pigment-protein interactions. Changes in CD spectra can reveal alterations in the structural organization of photosynthetic complexes.

  • Electron Paramagnetic Resonance (EPR): Particularly useful for studying the redox centers and electron transfer components of photosynthetic complexes. EPR can detect changes in the environment of paramagnetic species, such as iron-sulfur centers, similar to the approach used for characterizing R. capsulatus XDH .

  • X-ray Absorption Spectroscopy: Provides detailed information about metal coordination environments in metalloproteins. This technique has been successfully applied to R. capsulatus XDH to probe iron and molybdenum centers and could similarly provide insights about metal cofactors in reaction centers.

  • Time-resolved fluorescence spectroscopy: Measures energy transfer kinetics within and between photosynthetic complexes, providing functional information about properly assembled complexes.

Each spectroscopic technique provides complementary information, and a comprehensive analysis typically requires multiple methods to fully characterize the structural and functional properties of the photosynthetic complexes.

How should contradictory results between spectroscopic and genetic analyses be reconciled?

When faced with contradictory results between spectroscopic and genetic analyses of puhA function, a systematic approach to reconciliation should include:

  • Verification of experimental procedures:

    • Confirm the genetic identity of all strains used (re-sequence the puhA region)

    • Verify spectroscopic instrument calibration and sample preparation

    • Repeat key experiments with additional controls

  • Consider physiological context:

    • Growth conditions can affect expression levels and complex assembly

    • Cell density and growth phase may influence spectroscopic properties

    • Environmental factors (light intensity, oxygen levels) can alter photosynthetic complex formation

  • Examine alternative interpretations:

    • Secondary mutations may have arisen during strain construction

    • Post-translational modifications might affect protein function but not genetic sequence

    • Compensatory pathways might be activated in certain genetic backgrounds

  • Design reconciliation experiments:

    • Time-course studies to track the sequence of molecular events

    • Dose-response experiments with complementation constructs

    • Isolation and characterization of suppressor mutations

  • Employ complementary techniques:

    • Protein-protein interaction studies (co-immunoprecipitation, crosslinking)

    • In vitro reconstitution of complexes with purified components

    • Single-cell analyses to identify potential heterogeneity in the population

This systematic approach helps establish whether contradictions reflect experimental artifacts, biological complexity, or novel regulatory mechanisms in photosynthetic complex assembly.

What statistical approaches are most appropriate for analyzing complex datasets from puhA mutation studies?

For complex datasets from puhA mutation studies, several statistical approaches are particularly valuable:

  • Multivariate analysis techniques:

    • Principal Component Analysis (PCA) to identify major sources of variation in spectroscopic or proteomic data

    • Cluster analysis to group similar mutant phenotypes and identify patterns

    • Partial Least Squares (PLS) regression to correlate spectroscopic features with functional outcomes

  • Experimental design considerations:

    • For large datasets, optimally designed subsampling can achieve similar precision to random samples twice as large

    • Consider covariance structure in your data - positively correlated variables benefit most from designed sampling approaches

    • Visualize the coverage of your design space to ensure adequate representation of important parameter regions

  • Model selection and validation:

    • Use information criteria (AIC, BIC) to select appropriate models

    • Implement k-fold cross-validation to assess predictive performance

    • Bootstrap resampling to estimate parameter uncertainty

  • Time-series analysis:

    • For dynamic studies of complex assembly, mixed-effects models can account for within-subject correlations

    • Change-point detection methods to identify critical time points in assembly pathways

The appropriate statistical approach depends on the specific experimental design and research questions. For example, when comparing multiple puhA mutants across different growth conditions, a mixed-effects model might be most appropriate, whereas a principal component analysis would be valuable for interpreting complex spectroscopic datasets.

How can puhA gene modifications be used to study energy transfer mechanisms in photosynthetic systems?

Strategic modifications of the puhA gene can provide valuable insights into energy transfer mechanisms in photosynthetic systems:

  • Site-directed mutagenesis targeting the interaction surfaces between the H subunit and other reaction center components can alter the geometric arrangement of pigments, affecting energy transfer efficiency and pathways.

  • Introduction of cysteine residues at specific positions allows for attachment of spectroscopic probes (fluorescent dyes, spin labels) to monitor local conformational changes and distances between components during energy transfer.

  • Construction of chimeric H subunits incorporating domains from different species can reveal the structural determinants of species-specific energy transfer characteristics.

  • Deletion or modification of specific domains can identify regions involved in stabilizing the optimal geometry for efficient energy transfer.

  • Introduction of non-natural amino acids at strategic positions using expanded genetic code techniques can provide novel spectroscopic handles for studying energy transfer dynamics.

Each modification should be assessed using a combination of structural, spectroscopic, and functional approaches. Time-resolved spectroscopy is particularly valuable for directly measuring energy transfer rates and efficiencies in modified complexes. Correlation of these measurements with structural alterations can establish structure-function relationships in the energy transfer process.

What are the best approaches for integrating computational modeling with experimental data in puhA research?

Effective integration of computational modeling with experimental data for puhA research requires a multi-faceted approach:

  • Structure prediction and refinement:

    • Homology modeling based on crystal structures of related reaction centers

    • Refinement using experimental constraints from spectroscopic data

    • Molecular dynamics simulations to explore conformational flexibility

  • Quantum mechanical calculations:

    • Calculate electronic properties of pigments and their interactions

    • Predict spectroscopic properties that can be compared with experimental measurements

    • Model electron transfer pathways and energetics

  • Systems biology approaches:

    • Kinetic modeling of reaction center assembly pathways

    • Flux balance analysis to predict metabolic consequences of puhA mutations

    • Gene regulatory network modeling to understand transcriptional responses

  • Bayesian integration frameworks:

    • Utilize prior distributions based on existing knowledge

    • Update model parameters with new experimental data

    • Quantify uncertainty in predictions

  • Machine learning approaches:

    • Train models on spectroscopic data to predict structural features

    • Identify patterns in complex datasets that may not be apparent in traditional analyses

    • Generate hypotheses for experimental testing

The key to successful integration is iterative refinement, where computational predictions guide experimental design, and experimental results inform model improvement. This cycle continues until models accurately reproduce experimental observations and provide mechanistic insights into puhA function.

How can directed evolution be applied to engineer enhanced functionality in the puhA gene product?

Directed evolution offers powerful approaches for engineering enhanced functionality in the puhA gene product:

This approach can yield puhA variants with improved properties such as enhanced stability, altered spectral characteristics, or increased efficiency of energy capture and transfer, providing both biotechnological applications and fundamental insights into structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.