Recombinant Rhodobacter capsulatus Reaction center protein M chain (pufM)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Rhodobacter capsulatus Reaction Center Protein M Chain (pufM) is a critical component of the photosynthetic apparatus in this purple nonsulfur bacterium. Encoded by the pufM gene within the puf operon, this protein forms part of the reaction center (RC) complex, which facilitates light-driven electron transport during anaerobic photosynthesis . Recombinant expression of pufM enables structural, functional, and biochemical studies to elucidate its role in RC assembly and photochemical activity.

Gene and Protein Characteristics

  • Gene location: The pufM gene is part of the puf operon, which also encodes RC L, LH1 α/β polypeptides, and PufX .

  • Protein structure:

    • Contains transmembrane domains critical for binding bacteriochlorophyll (BChl) and quinones .

    • Classified under the Pfam database (PFAM: PF00124) as a member of the photosynthetic reaction center family .

Role in Photosynthesis

  • Core function: pufM stabilizes cofactors (e.g., BChl, quinones) within the RC, enabling light-driven charge separation .

  • Interactions: Cooperates with PufX and LH1 polypeptides to maintain RC-LH1 complex integrity .

Host Organisms and Purification

Recombinant pufM has been expressed in multiple heterologous systems:

Host SystemExpression VectorPurityKey FeaturesSource
Escherichia colipMal-c (MBP fusion)≥85%Affinity purification via maltose-binding protein
Cell-Free SystemsCustom plasmids≥85%Rapid production for structural studies

Challenges in Expression

  • Membrane integration: pufM requires chaperones like PuhB for proper folding and integration into lipid bilayers .

  • Stability: Recombinant pufM exhibits sensitivity to oxidative damage, necessitating anaerobic purification protocols .

RC Assembly Mechanisms

  • PufM-PufQ synergy: Co-expression with PufQ enhances RC assembly efficiency by 74%, likely through BChl trafficking .

  • Impact of PuhB: Disruption of puhB reduces RC levels to 12% of wild-type, underscoring its role in pufM stability .

Functional Reconstitution

  • In vitro assays: Reconstituted pufM with LH1 α/β and BChl restores light-harvesting activity, confirmed by carotenoid bandshift measurements .

  • Kinetic studies: Flash-induced spectroscopy revealed impaired quinol transfer in pufM mutants lacking PufX .

Synthetic Biology

  • Biohybrid systems: Engineered pufM variants are integrated into artificial photosynthetic devices for solar energy conversion .

Future Directions

  • High-throughput mutagenesis: To identify residues critical for BChl binding and electron transport .

  • Industrial scaling: Optimizing cell-free systems for large-scale pufM production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on shipping method and location. Consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted to customer preference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us for prioritized development.
Synonyms
pufM; Reaction center protein M chain; Photosynthetic reaction center M subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-307
Protein Length
Full Length of Mature Protein
Species
Rhodobacter capsulatus (Rhodopseudomonas capsulata)
Target Names
pufM
Target Protein Sequence
AEYQNFFNQVQVAGAPEMGLKEDVDTFERTPAGMFNILGWMGNAQIGPIYLGIAGTVSLA FGAAWFFTIGVWYWYQAGFDPFIFMRDLFFFSLEPPPAEYGLAIAPLKQGGVWQIASLFM AISVIAWWVRVYTRADQLGMGKHMAWAFLSAIWLWSVLGFWRPILMGSWSVAPPYGIFSH LDWTNQFSLDHGNLFYNPFHGLSIAALYGSALLFAMHGATILAVTRFGGERELEQIVDRG TASERAALFWRWTMGFNATMEGIHRWAIWMAVMVTLTGGIGILLSGTVVDNWYVWAQVHG YAPVTP
Uniprot No.

Target Background

Function

The reaction center is a membrane-bound protein complex that initiates the photochemical events in the photosynthetic electron transfer process.

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular chromatophore membrane; Multi-pass membrane protein.

Q&A

What is the function of the pufM gene in Rhodobacter capsulatus?

The pufM gene encodes the M subunit of the photosynthetic reaction center (RC) in Rhodobacter capsulatus. This protein forms part of the essential RC complex that, together with light-harvesting complex 1 (LH1) and the PufX polypeptide, constitutes the photosynthetic core complex. The RC is intimately associated with LH1, and this association is critical for photosynthetic function . The pufM protein specifically participates in the electron transfer reactions that convert light energy to chemical energy during bacterial photosynthesis, making it a fundamental component of the photosynthetic apparatus.

How is pufM gene expression regulated in R. capsulatus?

The pufM gene is part of the pufQBALMX operon, which is subject to complex regulation based on oxygen and light availability. Under aerobic conditions, expression is minimal, while under semiaerobic and anaerobic illuminated (photosynthetic) conditions, expression increases . Regulatory elements include promoter regions that respond to oxygen tension and potentially stem-loop structures in the mRNA that can affect transcription termination and mRNA stability. When designing recombinant expression systems, consideration of these regulatory elements is crucial to achieve optimal expression levels .

What is the relationship between pufM and other photosynthetic proteins?

The pufM protein functions in coordination with other proteins encoded by the puf operon (pufQBALMX). It specifically interacts with the L subunit (pufL) to form the functional reaction center. Additionally, the proper assembly and abundance of the RC, including pufM, appear to be influenced by accessory proteins such as PuhB, which has been shown to be required for optimal assembly of RC polypeptides and cofactors . The relationship between these proteins follows a hierarchical assembly process, where defects in one component can cascade to affect the assembly and function of other components in the photosynthetic apparatus.

What are the optimal methods for creating recombinant constructs containing pufM?

For recombinant expression of pufM, a two-step cloning approach is recommended:

  • Initial construct creation in a high-copy E. coli vector (e.g., pUC19)

  • Transfer of the construct to a broad host-range plasmid capable of replication in R. capsulatus

The following broad host-range plasmids have been successfully used in Rhodobacter research:

  • pRK415

  • pBBR1

  • pJRD215

  • pATP19P

When designing a synthetic operon containing pufM, important considerations include:

  • Selection of an appropriate promoter (e.g., hypoxia-inducible puc promoter)

  • Careful examination of potential mRNA secondary structures that might affect expression

  • Inclusion of all necessary genes (pufL, pufM, and potentially pufX) to ensure proper assembly

How can researchers optimize the expression of recombinant pufM protein?

Optimization of recombinant pufM expression requires careful attention to several factors:

  • Promoter selection: The hypoxia-inducible puc promoter has been successfully used for controlling expression of RC proteins in Rhodobacter species .

  • mRNA stability engineering: Researchers should analyze and potentially modify sequences that might form stem-loop structures that could attenuate transcription. In one documented case, replacement of 83 bp downstream of a stop codon with a restriction site eliminated a problematic stem-loop structure and significantly improved expression .

  • Growth conditions: Semi-aerobic conditions followed by a shift to anaerobic illuminated conditions can enhance expression of photosynthetic proteins including pufM.

  • Operon organization: Consider the relative positioning of genes within the synthetic operon. While some evidence suggests that trans expression is possible, the natural cis arrangement may provide optimal assembly conditions for the complete RC complex .

What purification techniques are most effective for recombinant pufM protein?

While the search results don't provide specific purification protocols for pufM alone, effective purification of RCs containing pufM typically involves:

  • Membrane solubilization using appropriate detergents (e.g., LDAO or DDM)

  • Column chromatography techniques:

    • Ion exchange chromatography

    • Size exclusion chromatography

    • Affinity chromatography (if tagged constructs are used)

When designing purification strategies, it's important to maintain the integrity of the RC complex, as pufM functions as part of this multi-protein assembly rather than as an isolated protein.

How do mutations in pufM affect RC assembly and function in Rhodobacter capsulatus?

Mutations in pufM can have various effects on RC assembly and function, depending on their location and nature. When investigating mutational effects, researchers should consider:

  • Structural impact: Mutations in transmembrane regions may disrupt protein folding or interaction with cofactors.

  • Functional regions: Mutations near cofactor binding sites can alter electron transfer kinetics.

  • Protein-protein interactions: Mutations at interfaces with pufL or other proteins can disrupt complex assembly.

Analysis of mutant phenotypes should include:

  • Spectroscopic characterization (absorption, fluorescence, circular dichroism)

  • Electron transfer kinetics measurements

  • Structural analysis where possible (crystallography or cryo-EM)

  • In vivo photosynthetic growth phenotypes

These analyses can provide insights into structure-function relationships within the RC complex.

What is the interplay between puhB and pufM in photosynthetic complex assembly?

Research has revealed that PuhB plays a critical role in RC assembly with secondary effects on LH1 assembly. The relationship between PuhB and pufM appears to be hierarchical:

  • PuhB functions in the assembly of RC polypeptides and cofactors, including pufM

  • Disruption of puhB diminishes RC assembly

  • This reduction in RC assembly indirectly affects LH1 assembly

  • The amount of PufX is also reduced in puhB mutants

Under semiaerobic growth conditions, puhB mutants show reduced levels of the core complex. When transferred to photosynthetic conditions, the RC/LH1 complex becomes only slightly more abundant, indicating that PuhB's role cannot be fully compensated for by other factors .

PuhB appears to be a membrane protein with three putative transmembrane segments that may form a dimer. Its specific molecular interaction with pufM remains to be fully characterized, but the evidence suggests it may function as an assembly factor or chaperone that helps with the proper folding or insertion of RC proteins including pufM .

How can synthetic biology approaches be used to study pufM function and assembly?

Synthetic biology offers powerful approaches for studying pufM function and assembly:

  • Synthetic operon construction: Creating custom operons containing pufM and other RC genes allows for controlled expression and systematic manipulation. This approach has successfully generated functional RC complexes in Rhodobacter species .

  • Host strain engineering: Development of deletion strains lacking native photosynthetic genes (e.g., DRCLH strain mentioned in the literature) provides a clean background for expressing recombinant constructs .

  • Regulatory element design: Careful engineering of promoters, ribosome binding sites, and terminator sequences allows fine control over expression levels.

A successful synthetic biology approach for RC research included:

  • Using the puc promoter to drive expression

  • Strategic placement of restriction sites for easy modification

  • Elimination of cryptic regulatory sequences

  • Consideration of mRNA secondary structure

These approaches have enabled rapid creation, expression, and purification of RCs with modifications to all three subunits, including pufM.

What are potential causes for low yields of recombinant pufM-containing complexes?

Several factors can contribute to low yields of recombinant pufM-containing complexes:

  • Transcriptional attenuation: Secondary structures in mRNA can prematurely terminate transcription. Analysis identified that sequences shortly after the 3' end of upstream genes could form stem-loop structures that attenuate transcription into downstream genes .

  • Assembly limitations: The assembly of pufM into functional RC complexes requires proper coordination with other proteins. Absence or dysfunction of assembly factors like PuhB can significantly reduce yields .

  • Growth conditions: Suboptimal oxygen tension or light conditions may not appropriately induce expression of the puf operon.

  • Host strain limitations: Some host strains may lack necessary accessory factors or may have competing pathways that reduce yield.

Solutions to these issues include:

  • Modification of mRNA secondary structures

  • Co-expression of assembly factors

  • Optimization of growth conditions

  • Selection of appropriate host strains

How can researchers distinguish between assembly defects and expression problems when analyzing pufM mutants?

Distinguishing between assembly defects and expression problems requires a systematic analytical approach:

  • Transcript analysis: Quantitative RT-PCR or Northern blotting to determine if pufM mRNA is being produced at normal levels.

  • Protein accumulation analysis: Western blotting with antibodies against pufM to detect unassembled protein.

  • Spectroscopic analysis: Near-infrared absorption spectroscopy can detect properly assembled RC complexes containing pufM.

  • Comparative studies: Analysis under different conditions (e.g., with and without PuhB) can help identify if the issue is with initial expression or subsequent assembly.

  • Subcellular localization: Determining whether pufM is properly localized to membranes or accumulating in inclusion bodies.

When PuhB is absent, both RC and LH1 components are reduced, but the primary defect appears to be in RC assembly, with secondary effects on LH1 . This pattern of results indicates an assembly defect rather than an expression problem.

What emerging technologies show promise for advancing pufM research?

Several emerging technologies offer new opportunities for pufM research:

  • Cryo-electron microscopy: Advances in cryo-EM now allow visualization of membrane protein complexes at near-atomic resolution, potentially providing new structural insights into pufM within the RC complex.

  • Single-molecule techniques: Methods such as single-molecule FRET could illuminate the dynamics of RC assembly and the role of pufM in this process.

  • In vivo labeling approaches: Techniques like SNAP-tag or split-GFP labeling could allow tracking of pufM assembly in living cells.

  • High-throughput mutagenesis: Methods like deep mutational scanning could systematically evaluate the effects of all possible amino acid substitutions in pufM.

  • Computational approaches: Advanced molecular dynamics simulations and machine learning approaches could predict structure-function relationships and guide experimental design.

How might research on R. capsulatus pufM inform our understanding of other photosynthetic systems?

Research on R. capsulatus pufM has broader implications for understanding:

  • Evolutionary conservation: Comparison of pufM structure and function across different photosynthetic bacteria can reveal conserved mechanisms of photosynthesis.

  • Assembly pathways: Insights into how bacterial RCs assemble may inform our understanding of more complex photosynthetic systems like photosystem II in plants and algae.

  • Protein-cofactor interactions: The principles governing how pufM interacts with its cofactors to facilitate electron transfer may be applicable to both natural and artificial photosynthetic systems.

  • Synthetic biology applications: Lessons learned from engineering pufM expression and assembly could inform design of artificial photosynthetic systems for solar energy capture and conversion.

  • Membrane protein biogenesis: General principles of membrane protein assembly and quality control uncovered through pufM research may be applicable to other membrane protein systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.