Recombinant Rhodobacter capsulatus Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhodobacter capsulatus Ubiquinol-cytochrome c Reductase Iron-Sulfur Subunit (petA)

The Recombinant Rhodobacter capsulatus Ubiquinol-cytochrome c Reductase Iron-Sulfur Subunit (petA) is a protein derived from the bacterium Rhodobacter capsulatus. This protein is part of the ubiquinol-cytochrome c reductase complex, also known as the cytochrome bc1 complex, which plays a crucial role in the electron transport chain of bacteria. The petA protein, specifically, is responsible for the iron-sulfur subunit within this complex.

Key Features:

  • Function: The petA protein is essential for electron transfer during the process of generating ATP in bacterial cells.

  • Expression: It is typically expressed in Escherichia coli for research and commercial purposes, often with an N-terminal His tag for purification.

  • Structure: The recombinant protein consists of 191 amino acids (1-191aa) and is fused with a His tag for easy purification.

Biological Role and Importance

The ubiquinol-cytochrome c reductase complex is pivotal in the respiratory chain of bacteria, facilitating the transfer of electrons from ubiquinol to cytochrome c. This process is crucial for generating a proton gradient across the membrane, which is used by ATP synthase to produce ATP.

Biological Significance:

  • Energy Production: The petA subunit is vital for maintaining the structural integrity and function of the cytochrome bc1 complex.

  • Electron Transfer: It helps in the efficient transfer of electrons, ensuring optimal energy production in bacterial cells.

Research Findings and Applications

While specific research on the recombinant petA protein from Rhodobacter capsulatus is limited, studies on similar proteins in other organisms highlight their importance in bioenergetics and potential applications in biotechnology.

Research Highlights:

  • Biotechnological Applications: Recombinant proteins like petA can be used in biofuel production, enhancing microbial energy metabolism.

  • Structural Studies: Understanding the structure of petA can provide insights into improving electron transport efficiency in bacterial systems.

References:

- Creative BioMart. Recombinant Full Length Rhodobacter Capsulatus Ubiquinol-Cytochrome C Reductase Iron-Sulfur Subunit(Peta) Protein, His-Tagged.
- PubMed. Identification of a stable ubisemiquinone and characterization of the effects of ubiquinone oxidation-reduction status on the Rieske iron-sulfur protein in the three-subunit ubiquinol-cytochrome c oxidoreductase complex of Paracoccus denitrificans.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; fbcF; RCAP_rcc02768; Ubiquinol-cytochrome c reductase iron-sulfur subunit; Rieske iron-sulfur protein; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Target Names
petA
Target Protein Sequence
MSHAEDNAGTRRDFLYHATAATGVVVTGAAVWPLINQMNASADVKAMASIFVDVSAVEVG TQLTVKWRGKPVFIRRRDEKDIELARSVPLGALRDTSAENANKPGAEATDENRTLPAFDG TNTGEWLVMLGVCTHLGCVPMGDKSGDFGGWFCPCHGSHYDSAGRIRKGPAPRNLDIPVA AFVDETTIKLG
Uniprot No.

Target Background

Function

Component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex), a respiratory chain component crucial for generating the electrochemical potential driving ATP synthesis.

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Rhodobacter capsulatus petA and what is its function?

The petA gene product in Rhodobacter capsulatus is the Ubiquinol-cytochrome c reductase iron-sulfur subunit, also known as the Rieske iron-sulfur protein (RISP). It functions as a critical component of the cytochrome bc1 complex (Complex III) in bacterial electron transport chains. The protein contains an iron-sulfur cluster that facilitates electron transfer from ubiquinol to cytochrome c during bacterial respiratory and photosynthetic processes. In its mature form, the R. capsulatus petA protein consists of 191 amino acids . The protein plays an essential role in both respiratory and photosynthetic growth of the bacterium, as demonstrated by growth experiments in MPYE media under various conditions .

How is the petA protein exported to its functional location?

The petA protein relies on the Twin-arginine translocation (Tat) pathway for proper export and localization. Studies in Shewanella oneidensis have shown that defects in this pathway significantly impact the export of petA, resulting in impaired aerobic growth. The Tat pathway recognizes a specific signal sequence in petA that directs it to the proper cellular compartment. Proper localization of petA is crucial for aerobic growth, as mislocalization predominantly accounts for growth defects observed in Tat pathway mutants . The signal peptide of petA contains a consensus motif that resembles the canonical Tat signal sequence (S/T-R-R-X-F-L-K), though it shows significant variation at the first residue position compared to other Tat substrates .

What methods are most effective for optimizing iron-sulfur cluster incorporation in recombinant petA?

Optimizing iron-sulfur cluster incorporation in recombinant petA requires careful consideration of expression conditions and post-translational processing. Researchers should consider:

  • Expression temperature control: Lower temperatures (16-20°C) during induction often improve proper folding and cluster incorporation.

  • Media supplementation: Adding iron (FeSO₄ or FeCl₃, typically 100-200 µM) and sulfur sources to expression media.

  • Co-expression strategies: Including iron-sulfur cluster assembly proteins (ISC or SUF system components) in the expression system.

  • Anaerobic purification: Performing protein extraction and purification under anaerobic conditions to prevent cluster oxidation.

  • Spectroscopic validation: Using UV-visible spectroscopy, EPR, and circular dichroism to confirm proper cluster incorporation.

The presence of the iron-sulfur cluster can be verified by the characteristic absorbance spectrum of the Rieske protein and its redox properties. Proper storage of the purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0 helps maintain stability and functionality .

How does the Tat pathway affect the localization and function of petA?

The Twin-arginine translocation (Tat) pathway is critical for the proper export and localization of petA. Research has shown that:

  • Signal peptide recognition: The Tat pathway recognizes specific features in the N-terminal signal peptide of petA, which contains a characteristic twin-arginine motif essential for recognition.

  • Folded protein transport: Unlike the Sec pathway, the Tat pathway transports fully folded proteins, which is crucial for petA as it contains the iron-sulfur cluster before translocation.

  • Growth phenotypes: Mutational studies in S. oneidensis have demonstrated that Tat pathway defects (ΔtatA, ΔtatC, and ΔtatABC mutants) result in impaired aerobic growth due to mislocalization of petA .

  • Experimental validation: GFP reporter systems fused to Tat signal peptides have been used to visualize protein localization in wild-type versus Tat-deficient strains through confocal microscopy .

Research has shown that the growth defect of Tat pathway mutants primarily stems from the mislocalization of petA, highlighting the critical relationship between this export pathway and petA function in aerobic respiration .

What strategies exist for engineering fusion proteins with petA?

Engineering fusion proteins with petA requires careful design to maintain functional integrity. Based on research with cytochrome bc1 complexes, the following strategies have proven effective:

  • Terminal selection: The C-terminus of petA is generally more amenable to fusion than the N-terminus, which contains the critical signal sequence for Tat-dependent export.

  • Linker design: Flexible linkers (e.g., (Gly₄Ser)n repeats) help maintain independent folding of fusion partners.

  • Domain preservation: Ensuring that the iron-sulfur cluster binding domain remains structurally intact is essential for maintaining electron transfer function.

  • Fusion partner selection: Reporter proteins like GFP have been successfully fused to study petA localization, while affinity tags (His, Strep, etc.) facilitate purification.

As demonstrated in studies with Rhodobacter capsulatus, cytochrome b fusions within the cytochrome bc1 complex have been successfully engineered to study complex assembly and function, providing a model for similar approaches with petA . When designing such constructs, researchers should consider both the structural constraints of the protein and the intended application of the fusion.

What mutagenesis approaches have been successful in studying petA function?

Several mutagenesis approaches have proven valuable for studying petA function:

  • Site-directed mutagenesis: Targeting specific residues involved in iron-sulfur cluster coordination or protein-protein interactions.

  • Domain swapping: Replacing segments of petA with homologous regions from related species to study evolutionary conservation and functional specificity.

  • Genomic array footprinting (GAF): This technique has been used to identify genetic elements affecting the function of petA and related proteins by creating and screening random mutant libraries .

  • Plasmid-based complementation: Using plasmids like pPET1 and pMTS1 that contain the petABC operon to complement deletion strains and study the effects of mutations .

  • Alanine scanning: Systematically replacing surface residues with alanine to map interaction surfaces.

For functional validation, growth assays under both aerobic and photosynthetic conditions provide valuable information about the impact of mutations on petA function . Spectroscopic analyses can further characterize the effects of mutations on iron-sulfur cluster properties and electron transfer capabilities.

What are the optimal storage conditions for maintaining petA stability?

Maintaining the stability of recombinant petA requires careful attention to storage conditions. Based on established protocols, the following guidelines are recommended:

  • Temperature: Store the purified protein at -20°C to -80°C for long-term storage.

  • Buffer composition: A Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to maintain protein stability .

  • Glycerol addition: Adding glycerol to a final concentration of 5-50% (with 50% being optimal for many applications) helps prevent freeze-thaw damage .

  • Aliquoting: Divide the purified protein into small aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity.

  • Working stock handling: For short-term use, store working aliquots at 4°C for up to one week .

  • Reconstitution procedure: Prior to use, briefly centrifuge the vial to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

These storage conditions help preserve both the structural integrity of petA and the functionality of its iron-sulfur cluster, which is crucial for maintaining its electron transfer capabilities.

What analytical techniques are most effective for characterizing recombinant petA?

Comprehensive characterization of recombinant petA requires a multi-technique approach:

  • SDS-PAGE and Western blotting: For purity assessment (>90% purity is typically achieved) and identity confirmation using specific antibodies against petA or its tag .

  • UV-visible spectroscopy: To verify the presence of the iron-sulfur cluster through its characteristic absorption spectrum.

  • Circular dichroism: For secondary structure analysis and thermal stability assessment.

  • EPR spectroscopy: To characterize the electronic properties of the iron-sulfur cluster.

  • Mass spectrometry: For accurate molecular weight determination and post-translational modification analysis.

  • Functional assays: Electron transfer activity can be measured using artificial electron donors/acceptors or reconstituted systems.

  • Protein-protein interaction studies: Techniques such as surface plasmon resonance or isothermal titration calorimetry to study interactions with other components of the cytochrome bc1 complex.

For structural studies, X-ray crystallography or cryo-electron microscopy provides detailed information about protein folding and the spatial arrangement of the iron-sulfur cluster within the protein matrix.

How can researchers troubleshoot low yields in recombinant petA expression?

When facing low yields of recombinant petA, researchers should systematically address potential issues:

  • Codon optimization: Analyze the codon usage in the expression host compared to Rhodobacter capsulatus, and optimize the gene sequence accordingly.

  • Expression strain selection: Test multiple E. coli strains specifically designed for iron-sulfur protein expression (e.g., SHuffle, OrigamiB).

  • Induction parameters: Optimize IPTG concentration (typically 0.1-0.5 mM), induction temperature (16-30°C), and duration (4-24 hours).

  • Media composition: Supplement with iron sources and consider using enriched media like Terrific Broth.

  • Expression construct design: Evaluate different fusion tags (His, GST, MBP) and their position (N- or C-terminal).

  • Solubility enhancement: Co-express with chaperones or solubility-enhancing fusion partners.

  • Cell lysis conditions: Optimize buffer composition, including salt concentration, reducing agents, and detergents if needed.

Systematic optimization of these parameters has been shown to significantly improve yields of recombinant iron-sulfur proteins similar to petA. Careful monitoring of each step in the expression and purification process allows identification of specific bottlenecks.

How can studies of petA contribute to understanding electron transport mechanisms?

Research on petA provides critical insights into electron transport mechanisms through several approaches:

  • Structure-function relationships: By correlating structural features of petA with its electron transfer properties, researchers can understand the fundamental principles governing biological electron transport.

  • Inter-protein interactions: Studies of how petA interacts with other components of the cytochrome bc1 complex illuminate the molecular basis of multi-protein electron transfer chains.

  • Comparative studies: Investigating petA across different bacterial species reveals evolutionary adaptations in electron transport systems to different environmental niches.

  • Q-cycle mechanism: petA plays a critical role in the Q-cycle, a central mechanism in bioenergetic systems that couples electron transfer to proton translocation.

  • Environment response: How petA function adapts to different growth conditions (aerobic vs. anaerobic, light vs. dark) in R. capsulatus provides insights into respiratory flexibility .

These studies contribute to the broader understanding of biological energy conversion and may inform the development of artificial electron transport systems for biotechnological applications.

What is the significance of petA in studying bacterial adaptation to different growth conditions?

The petA protein serves as an excellent model for studying bacterial adaptation to various environmental conditions:

  • Respiratory vs. photosynthetic growth: In Rhodobacter capsulatus, petA functions in both respiratory and photosynthetic electron transport chains, allowing study of regulatory mechanisms controlling these different growth modes .

  • Oxygen response: The critical role of petA in aerobic growth, as evidenced by growth defects in Tat pathway mutants, highlights its importance in oxygen-dependent metabolism .

  • Energy metabolism flexibility: By studying petA function under different growth conditions, researchers can understand how bacteria optimize their energy metabolism in response to environmental changes.

  • Growth phenotype correlation: The direct correlation between petA mislocalization and growth defects provides a clear phenotypic readout for studying protein export systems .

Research on petA in different growth conditions has been conducted using specialized media (MPYE) and controlled growth environments, with comparisons between wild-type and mutant strains revealing the functional importance of proper petA localization and activity .

How might emerging protein language models like PETA enhance research on petA?

Emerging computational approaches using protein language models such as PETA (Protein Evaluating the impact of Transfer learning with tokenization Analysis) offer new opportunities for petA research:

  • Sequence-function predictions: Advanced tokenization methods in protein language models can predict functional properties of petA variants without extensive experimental testing .

  • Structural insights: These models can inform structure prediction algorithms to generate more accurate models of petA and its interactions with other proteins.

  • Evolutionary analysis: By analyzing patterns in protein sequences across species, these models can provide insights into the evolutionary history and conservation of petA.

  • Mutation impact prediction: PETA and similar models can help predict the impact of specific mutations on petA function, guiding experimental design .

  • Integration with experimental data: Combining computational predictions with experimental validation creates a powerful approach for understanding petA structure-function relationships.

The PETA benchmark includes 33 datasets across 15 protein-related tasks, offering diverse applications for protein research including protein fitness prediction, localization prediction, and protein-protein interaction prediction . These computational tools can accelerate research on petA by guiding experimental approaches and providing theoretical frameworks for interpreting results.

What techniques are emerging for studying petA interactions within the cytochrome bc1 complex?

Cutting-edge techniques for studying petA interactions within the cytochrome bc1 complex include:

  • Cryo-electron microscopy: Provides high-resolution structural information about the intact complex without crystallization, revealing the native arrangement of petA relative to other subunits.

  • Cross-linking mass spectrometry: Identifies specific interaction points between petA and other complex components through chemical cross-linking followed by mass spectrometric analysis.

  • Single-molecule FRET: Measures dynamic interactions and conformational changes between labeled components in real-time.

  • Nanodiscs and lipid bilayer systems: Allow study of the cytochrome bc1 complex in a native-like membrane environment to better understand how lipid composition affects petA function.

  • Fusion protein approaches: Engineering of fused cytochrome subunits, as demonstrated with cytochrome b fusion proteins, provides insights into complex assembly and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.