Recombinant Rhodobacter sphaeroides ATP synthase subunit b' (atpG)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rhodobacter sphaeroides ATP synthase subunit b' (atpG)

Recombinant Rhodobacter sphaeroides ATP synthase subunit b' (atpG) is a component of the F1F0 ATP synthase complex in Rhodobacter sphaeroides . ATP synthase, or F-ATPase, is an enzyme complex that produces adenosine triphosphate (ATP), the primary energy currency in cells . The atpG gene encodes the subunit b' of this ATP synthase .

Key Features and Characteristics

FeatureDescription
SpeciesRhodobacter sphaeroides
SynonymsatpX, ATP synthase F(0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'
Gene NameatpG
Uniprot No.Q3IZ14
AA SequenceMETEVHEAAGAAGHAGQAVGMPQLNFDYWPNQIFWLLVTLVAIYFLLTRVALPRIGAVLAERRGTITNDLAAAEELKQKAVLAEKAYNEALAKARAEAQAIVAETRAAIQAELDEATAKADAEISAKSAESEARIAEIRAGALQSVSEVAKDTAEALVAALGGKSDAAAVDAAVAARMKG
Expression Region1-180
Storage BufferTris-based buffer, 50% glycerol
PurityGreater than 90% as determined by SDS-PAGE (for similar proteins)
StorageStore at -20℃; for extended storage, conserve at -20℃ or -80℃. Avoid repeated freezing and thawing. Store working aliquots at 4℃ for up to one week .

Role and Function of ATP synthase subunit b' (atpG)

The b subunit is vital for the assembly of a functional F1F0 ATP synthase . Research indicates that the dimerization of the b subunit is essential for its interaction with the F1-ATPase portion of the complex .

Importance in Photosynthesis and Energy Production

Rhodobacter sphaeroides is a photosynthetic bacterium, and ATP synthase plays a crucial role in its energy production during photosynthesis . The enzyme uses the proton gradient generated across the bacterial membrane during photosynthetic electron transport to synthesize ATP .

Recombinant Production and Applications

Recombinant ATP synthase subunit b' (atpG) is produced in E. coli expression systems and has uses in biochemical research .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
atpF2; atpG; Rsph17029_2697; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Target Names
atpF2
Target Protein Sequence
METEVHEAAGAAGHAGQAVGMPQLNFDYWPNQIFWLLVTLVAIYFLLTRVALPRIGAVLA ERRGTITNDLAAAEELKQKAVLAEKAYNEALAKARAEAQAIVAETRAAIQAELDEATAKA DAEISAKSAESEARIAEIRAGALQSVSEVAKDTAEALVAALGGKSDAAAVDAAVAARMKG
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel. These are linked by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. The b'-subunit is a component of the F(0) channel, forming part of the peripheral stalk and connecting F(1) and F(0). It represents a divergent and duplicated form of the b-subunit found in plants and photosynthetic bacteria.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the genomic organization of ATP synthase genes in Rhodobacter sphaeroides compared to related species?

In Rhodobacter species, ATP synthase genes are typically organized into two separate operons: one containing the F₁ sector genes and another containing the F₀ sector genes. In closely related Rhodobacter capsulatus, the F₁ sector is encoded by the atpHAGDC operon, where atpG codes for the b' subunit . This organization differs from some other bacteria where F₀ and F₁ genes are in a single operon. Comparative genomic analysis shows this split operon arrangement is also present in other Rhodospirillaceae family members such as Rhodospirillum rubrum and Rhodopseudomonas blastica . The promoter region for the F₁ operon in R. capsulatus has been identified by primer extension analysis, featuring conserved elements seen in other Rhodobacter operons, particularly a TTG stretch in the -35 element .

How essential is the ATP synthase complex for Rhodobacter survival?

ATP synthase appears to be essential for Rhodobacter species under all tested growth conditions. Research with R. capsulatus demonstrated that it was impossible to obtain viable cells carrying ATP synthase gene deletions in the chromosome . Multiple attempts to generate deletion mutants in the atpHAGDC operon under various growth conditions (aerobic, photosynthetic, anaerobic with DMSO as electron acceptor) were unsuccessful . This indicates that a functional ATP synthase is indispensable for R. capsulatus survival, highlighting the critical role of all components, including the atpG gene product. This essentiality creates significant challenges for genetic manipulation experiments focusing on ATP synthase components.

What sequence conservation exists for atpG across bacterial species?

The atpG gene product in Rhodobacter species shows significant sequence conservation with other photosynthetic bacteria. While the search results don't specifically detail atpG conservation, they note that the α and β subunits of ATP synthase (encoded by atpA and atpD respectively) show striking identities with sequences from other photosynthetic bacteria: 79% and 89% identity with Rhodospirillum rubrum and Rhodopseudomonas blastica β subunits respectively, and 74% and 86% with their α subunits . Sequence homology extends to non-photosynthetic eubacterial ATP synthases as well, with considerable identity to E. coli components (69% and 55% for these subunits) . Given this pattern of conservation among F₁ subunits, it's likely that atpG also shows significant conservation, particularly among alpha-proteobacteria.

What genetic engineering techniques can be used to study recombinant atpG in Rhodobacter sphaeroides?

Several genetic engineering approaches have been developed for Rhodobacter sphaeroides that can be applied to study recombinant atpG:

  • BioBrick™ Systems: A modular genetic system consisting of characterized promoters, ribosome-binding sites (RBSs), and terminators has been developed for R. sphaeroides . This system includes:

    • Seven characterized promoters

    • Seven ribosome-binding sites (RBSs)

    • Five characterized terminators

  • Complementation Strategies: For essential genes like ATP synthase components, researchers have developed complementation approaches. For example, with R. capsulatus, a combination of gene transfer agent (GTA) transduction with conjugation allowed the construction of strains carrying mutations in indispensable genes .

  • In-frame Deletion with Ectopic Expression: As demonstrated with other essential genes in R. sphaeroides (like RSP_0847), an approach involving ectopic expression from a plasmid can enable deletion of the chromosomal copy . This method involves:

    • Creating a construct for constitutive expression of the target gene from a plasmid

    • Using recombineering to delete the chromosomal copy while maintaining function through the plasmid-expressed version

While the available genetic toolkit for R. sphaeroides is more limited compared to traditional platforms like E. coli, these approaches provide viable strategies for engineering recombinant atpG experiments .

How can researchers overcome the challenges of studying essential genes like atpG in Rhodobacter?

Studying essential genes like atpG in Rhodobacter species requires specialized approaches:

  • Conditional Expression Systems: Implement regulatable promoters that allow controlled expression of the essential gene, enabling studies under varying expression levels without complete loss of function.

  • Combined Transduction-Conjugation Method: As demonstrated with R. capsulatus, researchers successfully combined gene transfer agent (GTA) transduction with conjugation to introduce mutations in essential genes . This method represents "an easy way to construct strains carrying mutations in indispensable genes" .

  • Ectopic Complementation Strategy: For R. sphaeroides, researchers have successfully deleted essential genes from the chromosome by first expressing a functional copy from an ectopic plasmid . This approach was validated for the essential response regulator RSP_0847, where researchers "were able to efficiently recover in-frame deletions of the genomic copy of RSP_0847" when a plasmid-expressed copy was present .

  • Site-Directed Mutagenesis: Rather than complete deletion, introducing specific mutations that alter function without eliminating it entirely can provide insights into essential gene functions while maintaining viability.

The key challenge is maintaining cell viability while manipulating the gene of interest—these approaches offer methodological solutions by ensuring a functional copy remains available throughout the experimental procedure.

How does atpG function within the Design-Build-Test-Learn (DBTL) framework for R. sphaeroides as a microbial cell factory?

Within the DBTL framework for developing R. sphaeroides as a microbial cell factory, atpG manipulation presents both challenges and opportunities:

  • Design Phase: ATP synthase engineering, including atpG modifications, can be part of metabolic engineering strategies to optimize energy conversion efficiency in R. sphaeroides. Design considerations should incorporate:

    • Substrate-specific optimization of ATP production pathways

    • Integration with the metabolic versatility of R. sphaeroides, which can utilize various substrates including C1 compounds

    • Genome-scale metabolic models that account for ATP synthesis and utilization

  • Build Phase: Implementation of atpG modifications must navigate the essential nature of ATP synthase genes. Available tools include:

    • The BioBrick™ system developed for R. sphaeroides for controlled expression

    • Complementation strategies similar to those used for other essential genes

    • Fine-tuning of expression levels using the characterized promoters and RBSs available for this organism

  • Test Phase: Evaluation of modifications involves characterizing:

    • Growth parameters under different substrate conditions

    • ATP production rates and cellular energy status

    • Impact on production of target compounds like isoprenoids, poly-β-hydroxybutyrate, or hydrogen

  • Learn Phase: Data integration to refine further engineering approaches, potentially including:

    • Systems biology approaches like those used to study the CenKR two-component system

    • Integration of -omics data to understand global metabolic impacts of ATP synthase modifications

The challenge with ATP synthase components like atpG is balancing engineering objectives with the essential nature of the complex, requiring careful design strategies that modify function without compromising viability.

What structural and functional insights can be gained from expressing recombinant atpG in heterologous systems?

Expression of recombinant R. sphaeroides atpG in heterologous systems can provide several research insights:

  • Structural Analysis: Recombinant expression facilitates:

    • Purification of the b' subunit for crystallographic or cryo-EM studies

    • Investigation of protein-protein interactions within the ATP synthase complex

    • Comparative structural analysis with b' subunits from other organisms

  • Functional Complementation Studies: Expressing R. sphaeroides atpG in other bacterial species with ATP synthase mutations can reveal:

    • Functional conservation across species

    • Species-specific adaptations in ATP synthase assembly

    • Essential structural domains through complementation analysis with truncated variants

  • Chimeric ATP Synthase Studies: Creation of hybrid complexes containing components from different species can provide insights into:

    • Compatibility requirements between F₁ and F₀ sectors

    • Functional domains responsible for species-specific characteristics

    • Evolution of ATP synthase across bacterial lineages

  • Post-translational Modifications: Heterologous expression systems can reveal:

    • Differences in processing between native and recombinant forms

    • Potential regulatory modifications that affect function

    • Species-specific modifications required for proper function

The data from R. capsulatus studies indicated that "all amino-terminal methionines are processed" in ATP synthase subunits, highlighting the importance of understanding post-translational processing when working with recombinant forms.

What are the primary technical challenges in purifying functional recombinant atpG from R. sphaeroides?

Purification of functional recombinant atpG from R. sphaeroides presents several technical challenges:

  • Membrane Association: The b' subunit interacts with both the membrane-embedded F₀ and peripheral F₁ sectors, potentially complicating solubilization and purification while maintaining native conformation.

  • Protein Stability: ATP synthase subunits often depend on interactions with other complex components for stability. When expressed individually, they may:

    • Misfold without binding partners

    • Aggregate during purification procedures

    • Lose functional conformation

  • Post-translational Processing: Evidence from R. capsulatus indicates that ATP synthase subunits undergo N-terminal methionine processing , suggesting that recombinant expression systems must support proper processing.

  • Expression Host Considerations: When expressing in heterologous hosts:

    • Codon optimization may be necessary for efficient expression

    • The choice between homologous vs. heterologous expression systems presents tradeoffs between authenticity and yield

    • Different detergents may be required for effective solubilization depending on the host membrane composition

  • Functional Verification: Unlike enzymatic subunits, structural components like b' lack easily measurable individual activities, making functional verification challenging.

These challenges can be addressed through strategies such as co-expression with interacting partners, optimization of solubilization conditions, and designing fusion constructs that enhance stability while permitting site-specific cleavage to obtain the native protein.

How does atpG contribute to the broader cell envelope maintenance in Rhodobacter species?

While ATP synthase is primarily known for its role in energy conversion, research suggests potential connections between ATP synthase components and cell envelope maintenance in Rhodobacter species:

  • Cell Envelope Integrity: In R. sphaeroides, disruption of cell envelope regulators leads to "alterations in shape, increased phospholipid content, and sensitivity to detergents and β-lactam antibiotics" . While not directly implicating atpG, these findings highlight the interconnection between energy metabolism and envelope integrity.

  • Regulatory Networks: The essential CenKR two-component system in R. sphaeroides plays "a direct role in maintenance of the cell envelope, regulates the expression of subunits of the Tol-Pal outer membrane division complex, and indirectly modulates the expression of peptidoglycan biosynthetic genes" . Given the essential nature of both ATP synthase and the CenKR system, there may be regulatory interactions between these pathways.

  • Energy-Dependent Processes: Many cell envelope maintenance processes require ATP, creating a functional relationship between ATP synthase activity and envelope homeostasis:

    • Active transport across membranes

    • Cell wall biosynthesis

    • Protein secretion and membrane protein insertion

  • Potential Physical Interactions: The b' subunit, as part of the peripheral stalk of ATP synthase, interacts with the membrane and could potentially have secondary roles in membrane organization or stability beyond its primary function in ATP synthesis.

Research exploring these connections would benefit from approaches combining targeted genetic manipulations with systems biology techniques like those used in the CenKR studies, including "ChIP-seq and RNA-seq, to identify genes whose expression are directly and indirectly impacted" by ATP synthase alterations.

How might atpG be engineered to optimize ATP production for biotechnological applications?

Engineering atpG for optimized ATP production in R. sphaeroides could involve several approaches:

  • Sequence Optimization Based on Comparative Analysis:

    • Identifying key residues that differ between R. sphaeroides and other organisms with higher ATP synthase efficiency

    • Engineering chimeric b' subunits incorporating beneficial features from other species

    • Systematic mutagenesis of the interface regions between b' and other subunits

  • Stability Engineering:

    • Introducing mutations that enhance thermostability for increased robustness in industrial settings

    • Modifying the subunit to improve its resistance to proteolysis

    • Engineering disulfide bonds or other stabilizing interactions

  • Integration with Metabolic Engineering Goals:

    Engineering ApproachPotential BenefitChallenges
    Expression level optimizationBalanced ATP productionMaintaining proper stoichiometry
    Interface optimizationEnhanced coupling efficiencyPreserving complex assembly
    Promoter engineeringConditional ATP productionMaintaining essential function
    Fusion protein approachesDirected assemblyPotential steric hindrance
  • Application-Specific Modifications:

    • For hydrogen production applications, engineering atpG to function optimally under the microaerobic or anaerobic conditions used in biohydrogen production

    • For isoprenoid production, optimizing ATP synthase to balance ATP consumption and production pathways

    • For poly-β-hydroxybutyrate production, engineering ATP synthase to function efficiently during accumulation phase

  • Leveraging the DBTL Approach:

    • Using systematic Design-Build-Test-Learn cycles to iteratively improve atpG performance

    • Employing high-throughput screening methods to evaluate multiple variants simultaneously

    • Incorporating computational models to predict the impact of modifications

The engineering efforts must navigate the essential nature of ATP synthase while introducing beneficial modifications, potentially requiring sophisticated genetic approaches like those described for other essential genes in Rhodobacter species .

What role might recombinant atpG play in understanding the evolution of ATP synthase across bacterial species?

Recombinant atpG from R. sphaeroides offers valuable opportunities for evolutionary studies:

  • Phylogenetic Analysis and Functional Verification:

    • Comparative analysis reveals high sequence conservation among ATP synthase components across photosynthetic bacteria

    • Recombinant atpG can be used in complementation studies to test functional conservation across evolutionary distance

    • Identification of critical conserved domains that have remained unchanged through evolutionary history

  • Structural Evolution Insights:

    • The organization of ATP synthase genes into separate F₀ and F₁ operons in Rhodobacter species represents a distinct evolutionary arrangement

    • Recombinant expression allows structural comparison of the b' subunit across species with different operon organizations

    • Investigation of co-evolution between interacting subunits

  • Adaptation to Metabolic Versatility:

    • R. sphaeroides exhibits remarkable metabolic flexibility , potentially requiring adaptations in ATP synthase

    • Recombinant atpG studies can reveal how the ATP synthase complex has evolved to accommodate diverse energy sources

    • Comparison with species having different metabolic capabilities may highlight adaptive changes

  • Experimental Evolution Approaches:

    Evolutionary QuestionExperimental ApproachExpected Insight
    Functional constraintsDirected evolution of atpGIdentification of mutable vs. constrained regions
    Adaptive pathwaysLaboratory evolution under selective pressuresPotential convergent solutions across species
    Host-specific requirementsCross-species complementationIdentification of species-specific interacting partners
  • Integration with Genomic Data:

    • The complete genome sequence of R. sphaeroides enables comprehensive comparative genomics

    • Recombinant expression studies can validate bioinformatic predictions about evolutionary relationships

    • Correlation between genomic context conservation and functional conservation across species

This research direction would contribute to fundamental understanding of both ATP synthase evolution and broader bacterial adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.