Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
rnfG; Rsph17029_3935; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Target Names
rnfG
Target Protein Sequence
MTDDTAAPPPRGPARDWKSSPLVSGLLLGLFSLVSALMLALASDATRGPIAARSAEDLLA SLAQVLPAALHDNDPTADIRTLADADEGAVRVYVATRGGAVTAVTFELTGYGYGGAIRVL MAVAADGTILGARVLSHTETPGLGDKIEIGKDDWIEGFAGRSLTDPGPAGWKVRRDGGVF DQFSGATITPRAVVGTIHRGLTLFDRHRAELLAPLPLRS
Uniprot No.

Target Background

Function
RnfG is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane.
Database Links
Protein Families
RnfG family
Subcellular Location
Cellular chromatophore membrane; Single-pass membrane protein.

Q&A

What is the functional role of RnfG in Rhodobacter sphaeroides electron transport?

RnfG functions as a critical component of the electron transport complex in Rhodobacter sphaeroides, participating in energy conservation processes. As part of the Rnf complex, RnfG likely contributes to the coupling of electron transfer with ion transport across the membrane. Similar to the electron transfer mechanisms studied in R. sphaeroides reaction centers, RnfG participates in the generation of a proton motive force that drives ATP synthesis. Research indicates that electron transfer in R. sphaeroides involves complex molecular orbital interactions that can be detected through ab initio calculations, with protein charges influencing electron transfer through both direct and indirect mechanisms . The RnfG protein likely contains iron-sulfur clusters that serve as redox centers, facilitating electron movement between membrane-bound respiratory complexes.

How is the rnfG gene regulated in Rhodobacter sphaeroides?

The regulation of rnfG appears to follow patterns similar to other R. sphaeroides genes involved in energy metabolism. Based on studies of R. sphaeroides promoters, many genes in this organism operate with promoters that differ significantly from the canonical E. coli model . Transcriptional regulators like CarD have been shown to play important roles in R. sphaeroides gene expression. For instance, CarD activates rRNA promoters but negatively regulates its own promoter . The rnfG gene likely responds to redox and energy status signals, possibly through transcription factors that sense cellular NAD+/NADH ratios. Metabolic shifts between photosynthetic and respiratory metabolism may trigger changes in rnfG expression patterns, reflecting the organism's adaptation to changing environmental conditions.

What structural characteristics define the RnfG protein?

RnfG is characterized by conserved domains typically associated with electron transport proteins. While the precise structure of R. sphaeroides RnfG has not been fully determined, comparative analysis with homologs suggests it contains transmembrane helices and redox-active centers. The protein likely adopts a conformation that positions its electron transfer components optimally within the membrane to facilitate efficient electron movement. Studies of electron transfer in R. sphaeroides reaction centers have demonstrated that protein structure significantly impacts the efficiency of electron movement, with side chain orientation and charge distribution playing critical roles . Molecular orbital overlap in the three-dimensional structure directly influences electron transfer rates, suggesting similar structural considerations would apply to RnfG function.

What are the optimal expression systems for producing recombinant R. sphaeroides RnfG?

For successful recombinant expression of R. sphaeroides RnfG, E. coli-based systems can be employed with specific modifications to accommodate the unique requirements of this membrane-associated electron transport protein. When expressing R. sphaeroides proteins in E. coli, researchers have successfully used systems similar to those employed for CarD protein expression . Key considerations include:

Expression System ComponentRecommended ApproachRationale
Expression vectorpET-based with T7 promoterHigh expression levels with inducible control
Host strainC41(DE3) or C43(DE3)Better tolerance for membrane proteins
Growth temperature18-25°C post-inductionReduces inclusion body formation
Induction conditions0.1-0.5 mM IPTG, OD600 ~0.6Balances yield with proper folding
Media supplementsIron and sulfur sourcesEnsures proper formation of Fe-S clusters

Successful expression requires careful optimization of these parameters, as the membrane-associated nature and potential toxicity of RnfG can pose challenges for heterologous expression systems.

How can electron transfer activity of RnfG be measured experimentally?

Measuring electron transfer activity of RnfG requires specialized techniques that can detect rapid redox changes. Drawing from approaches used in studying R. sphaeroides electron transfer , the following methodologies are recommended:

  • Spectroscopic techniques: UV-visible spectroscopy can track changes in the redox state of iron-sulfur clusters present in RnfG. Absorption peaks at characteristic wavelengths (typically 380-450 nm) indicate redox changes.

  • Electrochemical methods: Protein film voltammetry can be employed to measure direct electron transfer to/from RnfG immobilized on an electrode surface.

  • Synthetic electron acceptor assays: Using artificial electron acceptors such as methyl viologen or ferricyanide to measure RnfG-mediated electron transfer rates.

  • Stopped-flow kinetic measurements: These allow for the determination of electron transfer rates by rapidly mixing RnfG with electron donors/acceptors and monitoring spectral changes over millisecond timescales.

Analysis of electron transfer should consider protein charge effects, as studies have shown that protein charges influence electron transfer through both direct interactions and indirect effects mediated through side chains .

What approaches are effective for studying RnfG interactions with other electron transport components?

To elucidate RnfG's interactions within the electron transport network, several complementary approaches should be implemented:

  • Co-immunoprecipitation: Using antibodies against RnfG to pull down interaction partners from solubilized membranes, followed by mass spectrometry identification.

  • Bacterial two-hybrid screening: Modified bacterial two-hybrid systems suitable for membrane protein interactions can identify potential protein partners.

  • Cross-linking studies: Chemical cross-linkers with defined spacer lengths can capture transient interactions between RnfG and other components.

  • Blue native PAGE: This technique preserves protein complexes and can reveal the incorporation of RnfG into larger electron transport assemblies.

  • FRET-based approaches: Fluorescently-labeled RnfG and potential partners can be used to measure proximity in reconstituted systems or intact membranes.

The analysis of protein-protein interactions in membrane systems requires careful optimization of detergent conditions to maintain native-like environments while allowing sufficient solubilization for analytical techniques.

How should mutagenesis studies of RnfG be designed to investigate structure-function relationships?

When designing mutagenesis studies of RnfG, researchers should employ a systematic approach that targets key functional domains while considering the complex nature of electron transport proteins:

  • Targeted site-directed mutagenesis: Focus on conserved residues identified through sequence alignments of RnfG homologs across species. Priority should be given to:

    • Cysteine residues potentially involved in coordinating iron-sulfur clusters

    • Charged residues that may participate in electron transfer pathways

    • Residues at predicted protein-protein interaction interfaces

  • Alanine scanning: Systematically replace blocks of amino acids with alanine to identify regions essential for function.

  • Conservative vs. non-conservative substitutions: Compare effects of conservative substitutions (maintaining similar chemical properties) with non-conservative changes to determine the specific requirements at key positions.

When analyzing mutant phenotypes, researchers should implement standardized protocols that assess:

  • Protein expression levels using quantitative western blotting

  • Membrane localization and topology using fractionation methods

  • Electron transfer activity using the methods described in section 2.2

  • Protein stability using thermal shift assays

Experimental data should be documented in a standardized format similar to those used in protein engineering databases to facilitate cross-study comparisons .

What promoter systems are most effective for controlling expression of R. sphaeroides genes?

Based on research into R. sphaeroides promoters, effective expression systems should consider the unique characteristics of this organism's transcriptional machinery. R. sphaeroides promoters often lack the canonical −35 element found in E. coli promoters, suggesting a different mechanism of transcription initiation . When designing expression systems:

  • Native R. sphaeroides promoters: For work within R. sphaeroides, consider that:

    • The rrnB promoter is particularly strong and has been well-characterized

    • Many R. sphaeroides promoters lack a canonical −35 element but may contain extended -10 elements

    • Transcriptional regulators like CarD can significantly impact promoter activity, activating some promoters while repressing others

  • Heterologous expression in E. coli:

    • T7-based systems have been successfully used for R. sphaeroides proteins

    • Consider codon optimization, as R. sphaeroides has different codon usage preferences

    • Include appropriate secretion signals or membrane-targeting sequences for proper localization

The table below summarizes characteristics of R. sphaeroides promoters based on available research:

PromoterRelative StrengthResponse to CarDKey Features
rrnBHighActivated (~13-fold)Used for rRNA expression
rrnAMediumActivated (moderate)Weaker than rrnB
rrnCMediumActivated (moderate)Weaker than rrnB
carDMediumRepressed (~4-fold)Self-regulated by CarD protein

For precise control of RnfG expression levels, researchers should consider these promoter characteristics when designing expression constructs.

What bioinformatic approaches are most valuable for studying RnfG sequence-structure-function relationships?

Modern bioinformatic approaches offer powerful tools for investigating RnfG properties before experimental work:

  • Multiple sequence alignment analysis: Identify conserved residues across RnfG homologs that likely represent functionally critical positions. Tools like Clustal Omega, MUSCLE, or T-Coffee are recommended for alignment generation.

  • Structural modeling: In the absence of crystallographic data, homology modeling using tools like SWISS-MODEL or AlphaFold can generate predicted structures. These models can identify potential:

    • Iron-sulfur cluster binding sites

    • Membrane-spanning regions

    • Protein-protein interaction interfaces

  • Molecular dynamics simulations: These can predict how electrons might move through the protein structure, identifying likely electron transfer pathways.

  • Database integration: Leverage existing protein engineering databases like ProtaBank to systematically analyze and compare data across multiple studies. ProtaBank provides:

    • Standardized formats for reporting protein sequences and experimental data

    • Tools for comparing results across different datasets

    • Visualization tools to identify sequence-activity and structure-activity relationships

  • Coevolution analysis: Methods like Direct Coupling Analysis can identify residues that have coevolved, suggesting functional or structural relationships.

For the most effective analysis, researchers should use a combination of these approaches, as each provides complementary information about different aspects of RnfG biology.

How can researchers effectively analyze transcriptional regulation of rnfG?

To comprehensively analyze the transcriptional regulation of the rnfG gene, researchers should implement a multi-faceted approach that examines both in vivo and in vitro aspects of gene expression:

  • Promoter mapping and characterization:

    • Determine the transcription start site using primer extension or 5' RACE

    • Identify potential regulatory elements through DNase I footprinting and promoter deletion analysis

    • Consider that, like many R. sphaeroides promoters, the rnfG promoter may lack canonical -35 elements but contain extended -10 elements

  • In vitro transcription assays:

    • Follow methodologies used to study CarD-regulated promoters in R. sphaeroides

    • Test the effects of potential regulatory proteins such as CarD or other transcription factors

    • Analyze both full-length transcripts and abortive products to identify potential regulation at the level of promoter escape

  • Reporter gene assays:

    • Construct transcriptional fusions of the rnfG promoter with reporter genes

    • Test activity under various growth conditions and metabolic states

    • Compare to characterized promoters like rrnB to determine relative strength

  • RNA-seq and ChIP-seq approaches:

    • Determine rnfG expression profiles across growth conditions

    • Identify transcription factors that bind the rnfG promoter region

    • Map genome-wide binding sites of identified regulators

When analyzing transcriptional regulation, researchers should consider that RNA polymerase in R. sphaeroides appears to have different promoter recognition properties compared to E. coli RNA polymerase, which may impact experimental design and interpretation .

How can protein-membrane interactions of RnfG be studied effectively?

To elucidate how RnfG interacts with the membrane environment, researchers should employ techniques that preserve the native lipid environment while providing detailed structural information:

  • Nanodiscs and liposome reconstitution:

    • Reconstitute purified RnfG into nanodiscs with defined lipid compositions

    • Evaluate functional activity in these systems compared to detergent-solubilized preparations

    • Test the effects of different lipid compositions on RnfG function and stability

  • Site-directed spin labeling paired with EPR spectroscopy:

    • Introduce spin labels at strategic positions within RnfG

    • Measure accessibility parameters to determine membrane-embedded regions

    • Evaluate changes in protein dynamics in different membrane environments

  • Hydrogen-deuterium exchange mass spectrometry:

    • Identify regions of RnfG that are protected from exchange when membrane-embedded

    • Compare exchange patterns in detergent micelles versus lipid bilayers

    • Map differences to structural models to identify membrane interaction surfaces

These techniques should be combined with functional assays measuring electron transfer activity to correlate structural insights with functional properties.

What approaches can resolve contradictory data regarding RnfG function?

When confronted with conflicting experimental results regarding RnfG function, researchers should implement a systematic troubleshooting approach:

  • Source of protein preparation:

    • Compare results using RnfG expressed in different systems (native versus recombinant)

    • Ensure complete removal of contaminating proteins that might contribute to observed activities

    • Verify integrity of iron-sulfur clusters through spectroscopic analysis

  • Experimental conditions:

    • Systematically vary buffer conditions, pH, salt concentrations, and temperature

    • Test activity in different detergent systems and lipid environments

    • Consider that small amounts of contaminating proteins can significantly affect results, as seen with CarD contamination in RNA polymerase preparations

  • Analytical approaches:

    • Employ multiple independent methods to measure the same parameter

    • Quantify electron transfer using both direct (spectroscopic) and indirect (coupled enzyme) assays

    • Develop in vivo complementation assays to verify functional significance of in vitro findings

  • Collaborative cross-validation:

    • Establish standardized protocols and share materials between laboratories

    • Conduct blind tests with identical samples in different laboratories

    • Report negative results and experimental failures to identify systematic issues

When publishing results, researchers should thoroughly document experimental conditions and protein preparation methods to facilitate reproduction and comparison across studies, following standardized reporting formats similar to those used in ProtaBank .

What are the most promising future research directions for RnfG studies?

Based on current knowledge and technological capabilities, several research directions show particular promise for advancing our understanding of RnfG:

  • Structure-function studies:

    • Determination of high-resolution structures using cryo-EM or X-ray crystallography

    • Correlation of structural features with electron transfer mechanisms

    • Investigation of conformational changes during the catalytic cycle

  • Systems biology approaches:

    • Integration of RnfG function into whole-cell metabolic models

    • Elucidation of regulatory networks controlling rnfG expression

    • Synthetic biology applications leveraging RnfG for bioenergy applications

  • Methodological advances:

    • Development of real-time imaging techniques for tracking electron flow through RnfG in vivo

    • Application of advanced computational approaches to predict electron transfer pathways

    • Implementation of high-throughput screening methods for identifying RnfG variants with enhanced activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.