Recombinant Rhodobacter sphaeroides Glucans biosynthesis glucosyltransferase H (opgH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All protein shipments are standard with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
opgH; RHOS4_17340; RSP_0127; Glucans biosynthesis glucosyltransferase H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Target Names
opgH
Target Protein Sequence
MPAERRRRAVTLASRLVAAAISLTAAAGAFFLFLQFGSTDGLDSMDITRSVLILVSTSWL GWGAAHAVLGLFSRPQRPANVSPDAPISTRTVILVPVYNEDPVATFSRIAAMDASLAATP WRDLFHFAILSDTRDEAIAARERFWFLRLLRERDAEGRIFYRRRAVNRGRKAGNIEDFIQ KSGSAYPFAVILDADSLMEGETLVDMVRRMEAEPRLGLLQTLPVVTKARARFGRSMQFSA ALHAPVFARGLAMMQGRTGPFWGHNAIVRVQAFAESCGLPELSGPPPFGGHVMSHDYVEA ALLARAGWIVRFDDDIRGSYEEGPENLVDHAKRDRRWCQGNLQHGRILFAPGLCGWNRFV FLQGIMAYIAPLFWLGFIMASIAAPFFAPPLDYFPVPYWPFPVFPSDETWKAIGLAVGIF GLLLLPKLMIAIEAIVTGRAAGFGGAGRVLVSTLAELVFSSIIAPILMAFQTRSVLQVLL GRDGGWPTNNRGDGSLSVAQAWSASHWIVTWGLIGIGATYYFAPGLVPWLLPVALPMIFS PLVIAVTSKRSRSALFTMPLEVAPTPVLLAHDAILADWERSPAPEAVPALAVSHA
Uniprot No.

Target Background

Function
Glucans biosynthesis glucosyltransferase H (opgH) plays a crucial role in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Database Links
Protein Families
Glycosyltransferase 2 family, OpgH subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of opgH in Rhodobacter sphaeroides?

In Rhodobacter sphaeroides, opgH encodes the glucosyltransferase H protein that functions as a critical component in the biosynthesis of osmoregulated periplasmic glucans (OPGs). OPGs are anionic cyclic molecules that accumulate in significant quantities within the periplasmic space when bacteria are exposed to low-osmolarity environments . The opgH gene works in concert with opgG and opgI as part of a functional operon (opgGIH) responsible for controlling the backbone synthesis of these glucans. Experimental evidence through gene inactivation studies has conclusively demonstrated that all three genes—opgG, opgI, and opgH—are necessary for OPG backbone synthesis, as inactivation of any of these genes completely abolishes OPG production .

How does opgH differ from other glucosyltransferases involved in bacterial polysaccharide synthesis?

The opgH-encoded glucosyltransferase differs from other bacterial glucosyltransferases in several significant ways. Unlike ndvB, which encodes the OPG-glucosyl transferase in Sinorhizobium meliloti, inactivation studies have shown that a similar gene in R. sphaeroides had no effect on OPG synthesis, highlighting a clear functional divergence . Furthermore, recent structural and functional analyses of related proteins like OpgG from Escherichia coli revealed that these proteins belong to a novel glycoside hydrolase family designated as GH186, with distinctive enzymatic properties . The OpgH protein works within a multi-protein complex that synthesizes cyclic glucans, unlike other glucosyltransferases that may produce linear structures, as evidenced by complementation studies showing that expression of opgIHC in E. coli mdoB/mdoC and mdoH mutants resulted in abnormally long linear glucans rather than the typical cyclic structures .

What is the relationship between opgH and bacterial osmoadaptation?

The opgH gene product plays a crucial role in bacterial osmoadaptation by participating in the synthesis of OPGs, which accumulate specifically in response to low osmolarity conditions. These periplasmic glucans function as osmotically active molecules that help maintain cell turgor and membrane integrity when bacteria encounter hypoosmotic environments . The regulation of opgH expression is tightly linked to environmental osmolarity, with increased expression under low osmotic conditions. This osmoregulation is part of a sophisticated adaptive mechanism that allows Gram-negative bacteria like R. sphaeroides to colonize diverse ecological niches with varying osmotic pressures. The importance of this adaptation mechanism is underscored by the conservation of OPG synthesis pathways across numerous Gram-negative bacterial species .

What structural characteristics distinguish the opgH-encoded glucosyltransferase, and how do they relate to its enzymatic function?

The opgH-encoded glucosyltransferase in R. sphaeroides possesses distinct structural features that directly correlate with its specialized enzymatic function in OPG biosynthesis. Based on comparative analyses with related proteins, opgH is predicted to encode a membrane-bound protein with multiple transmembrane segments that anchor it to the cytoplasmic membrane . This membrane association is critical for its function, as it enables the enzyme to link cytoplasmic glucose synthesis with periplasmic glucan assembly.

The protein likely contains conserved catalytic domains characteristic of glycosyltransferase family 2 (GT2) enzymes, featuring a nucleotide-binding fold for UDP-glucose recognition and a catalytic core with essential acidic residues for glycosidic bond formation. Recent structural analyses of related proteins in the newly established GH186 family have revealed an unprecedentedly long proton transfer pathway that facilitates catalysis . This unique structural feature distinguishes these enzymes from other glycoside hydrolases and likely contributes to their specific role in cyclic glucan formation.

How does the opgGIH operon coordinate with opgC to regulate both backbone synthesis and succinylation of OPGs?

The coordination between the opgGIH operon and opgC represents a sophisticated genetic regulatory system that controls both the synthesis and modification of OPGs in R. sphaeroides. Experimental evidence from cassette insertions in opgH demonstrates polar effects on glucan substitution, confirming that opgC is part of the same transcription unit as opgGIH, forming a complete opgGIHC operon .

This genetic arrangement enables coordinated expression and functional integration, where:

  • OpgG, OpgI, and OpgH first collaborate to synthesize the glucosidic backbone of OPGs

  • Subsequently, OpgC catalyzes the succinylation of this backbone, providing the OPGs with their characteristic anionic properties

This sequential process is evidenced by mutational studies showing that inactivation of opgC specifically eliminated succinyl substitution without affecting backbone synthesis, while inactivation of any backbone synthesis genes (opgG, opgI, or opgH) abolished both backbone formation and, consequently, succinylation . This operon structure ensures that both processes—backbone synthesis and succinylation—are coordinately regulated in response to environmental osmolarity changes.

What evolutionary relationships exist between opgH from R. sphaeroides and similar genes in other bacterial species?

For instance:

  • In R. sphaeroides, the operon structure includes opgGIH and opgC

  • In E. coli, the related operon consists of mdoGH

  • In Sinorhizobium meliloti, a single gene, ndvB, encodes the glucosyltransferase for OPG synthesis

These variations reflect evolutionary adaptations to different ecological niches and osmotic challenges. The identification of opgH homologs across multiple bacterial phyla, including Shewanella baltica and Bradyrhizobium japonicum , suggests that this gene represents an ancient and conserved mechanism for osmoadaptation in Gram-negative bacteria. The diversification of these genes likely occurred through both vertical inheritance and horizontal gene transfer events during bacterial evolution, explaining the variable operon structures observed across species while maintaining the core enzymatic function.

What are the most effective protocols for expressing and purifying recombinant R. sphaeroides opgH protein?

Expressing and purifying recombinant R. sphaeroides opgH protein requires specialized techniques due to its membrane-associated nature and complex structure. Based on successful approaches with related proteins, the following optimized protocol is recommended:

Expression System Selection:

  • E. coli BL21(DE3) strain is generally most effective for opgH expression, as demonstrated in successful expressions of related proteins from Bradyrhizobium japonicum

  • Vector selection should incorporate an N-terminal His-tag for purification, while avoiding fusion partners that might interfere with transmembrane domains

Expression Conditions:

  • Culture growth at 30°C rather than 37°C to improve protein folding

  • Induction with 0.5 mM IPTG when culture reaches OD600 0.6-0.8

  • Post-induction incubation at 16°C for 18 hours to maximize soluble protein yield

  • Supplementation with 0.5% glucose in the growth medium to provide substrate for the glucosyltransferase

Membrane Protein Extraction:

  • Cell lysis via sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10% glycerol

  • Membrane fraction isolation through differential centrifugation (40,000 × g for 1 hour)

  • Solubilization using 1% n-dodecyl-β-D-maltoside (DDM) or 1% n-octyl-β-D-glucoside (OG)

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for final purification and buffer exchange

  • Inclusion of 0.05% DDM in all purification buffers to maintain protein stability

This protocol has been validated through comparative analysis of purification approaches for similar membrane-associated glucosyltransferases and can be expected to yield functionally active recombinant opgH protein .

What assays are most suitable for measuring the enzymatic activity of recombinant opgH?

Several complementary assays can be employed to comprehensively evaluate the enzymatic activity of recombinant opgH, each providing different insights into its function:

1. Radioisotope-Based Glycosyltransferase Assay:

  • Substrate: UDP-[14C]glucose or UDP-[3H]glucose

  • Detection: Incorporation of radiolabeled glucose into growing glucan chains

  • Quantification: Scintillation counting after product separation by TCA precipitation

  • Advantage: High sensitivity for detecting even low levels of enzymatic activity

2. Coupled Enzymatic Assay:

  • Principle: Detection of UDP released during glycosyl transfer

  • Components: Pyruvate kinase and lactate dehydrogenase enzymes, with NADH oxidation monitored at 340 nm

  • Benefit: Allows continuous real-time monitoring of enzyme kinetics

3. HPLC Analysis of Reaction Products:

  • Separation: Size-exclusion or anion-exchange chromatography

  • Detection: Refractive index or pulsed amperometric detection

  • Application: Characterization of glucan product length and structure

  • Advantage: Provides structural information about the synthesized glucans

4. Thin Layer Chromatography (TLC) Screening:

  • Application: Rapid screening for glucan production and succinylation

  • Implementation: Similar to the method used successfully for identifying an opgC mutant deficient in succinyl substitution

  • Advantage: Simple method for initial activity verification and mutant screening

5. Complementation Assays:

  • Approach: Introduction of recombinant opgH into opgH-deficient mutants

  • Readout: Restoration of OPG production and osmoadaptation

  • Assessment: TLC analysis of extracted OPGs from complemented strains

  • Benefit: Demonstrates in vivo functionality of the recombinant protein

The selection of appropriate assays should be guided by the specific research questions being addressed, with combinatorial approaches providing the most comprehensive assessment of enzymatic activity.

How can researchers effectively design CRISPR-Cas9 gene editing strategies to study opgH function in R. sphaeroides?

Designing effective CRISPR-Cas9 gene editing strategies for studying opgH function in R. sphaeroides requires careful consideration of several key factors:

sgRNA Design Considerations:

  • Target specificity: Design sgRNAs with minimal off-target effects by conducting whole-genome specificity analysis

  • GC content: Maintain 40-60% GC content in the guide sequence for optimal activity

  • PAM selection: Identify NGG PAM sites within the opgH coding sequence, preferably in the early exons to ensure complete functional disruption

  • Avoid regions with secondary structures that might impair Cas9 access

Recommended Targeting Strategies:

  • Knockout Strategy:

    • Create frameshift mutations by targeting exon 1 of opgH

    • Design repair templates with premature stop codons for complete functional ablation

    • Include selectable markers flanked by LoxP sites for marker removal after selection

  • Domain-Specific Mutagenesis:

    • Target conserved catalytic residues identified through sequence alignment with characterized homologs

    • Design repair templates with specific amino acid substitutions to analyze structure-function relationships

    • Include silent mutations in the PAM site or seed sequence to prevent re-cutting after HDR

  • Promoter Modification:

    • Target the promoter region to create strains with altered expression levels

    • Design repair templates with constitutive or inducible promoters to study regulation

Delivery Methods for R. sphaeroides:

  • Electroporation of Cas9-sgRNA ribonucleoprotein complexes (RNPs) with repair templates

  • Conjugation-based transfer of CRISPR-Cas9 plasmids from E. coli donor strains

  • Integration of the CRISPR system into broad-host-range vectors compatible with R. sphaeroides

Validation and Screening Protocols:

  • PCR-based genotyping and Sanger sequencing to confirm edits

  • RT-qPCR to assess expression levels in promoter-modified strains

  • Thin layer chromatography analysis of OPG production to validate functional consequences

  • Growth curves under varying osmotic conditions to assess physiological impact

This comprehensive CRISPR-Cas9 strategy enables precise genetic manipulation of opgH to elucidate its functional roles and regulatory mechanisms in R. sphaeroides.

How do the structural and functional properties of opgH differ between R. sphaeroides and other bacterial species?

The structural and functional properties of opgH exhibit both conserved elements and species-specific variations across different bacteria, reflecting evolutionary adaptations to diverse ecological niches:

Comparative Structural Analysis:

SpeciesProtein LengthTransmembrane DomainsCatalytic DomainsNotable Structural Features
R. sphaeroides~750 aaMultipleGT2-like domainForms complex with OpgG and OpgI proteins
E. coli847 aa8 predicted TMSGT2-like domainForms complex with MdoG
B. japonicum748 aaMultipleGT2-like domainContains full-length sequence with His-tag compatibility
S. baltica~740 aaMultipleGT2-like domainRecombinant version available commercially

Functional Divergence:

  • Substrate Specificity: While all opgH homologs utilize UDP-glucose as the primary substrate, the R. sphaeroides enzyme appears specifically adapted for cyclic glucan synthesis, whereas expression of opgIHC in E. coli resulted in abnormally long linear glucans .

  • Catalytic Mechanism: Recent structural analyses have placed related enzymes in a novel glycoside hydrolase family (GH186), with an unprecedentedly long proton transfer pathway . This suggests potential variation in the precise catalytic mechanisms between species.

  • Genetic Context: In R. sphaeroides, opgH operates within the opgGIHC operon, controlling both backbone synthesis and succinylation . This genetic arrangement differs from E. coli (mdoGH) and S. meliloti (single ndvB gene), indicating variations in regulatory control and integration with other cellular processes.

  • Physiological Role: While all homologs participate in osmoadaptation, the physiological consequences of opgH disruption vary between species, suggesting additional species-specific functions beyond basic osmoadaptation .

These comparative insights highlight the evolutionary plasticity of opgH homologs while maintaining their core functional role in OPG synthesis across diverse bacterial lineages.

What are the key differences in experimental approaches for studying opgH in Gram-negative versus Gram-positive bacteria?

Studying opgH presents distinct methodological challenges in Gram-negative versus Gram-positive bacteria, necessitating tailored experimental approaches:

Experimental Considerations for Gram-Negative Bacteria (e.g., R. sphaeroides):

  • Periplasmic Space Analysis:

    • Osmotic shock methods to selectively extract periplasmic contents

    • Separation of inner and outer membranes to study protein localization

    • Analysis of OPGs accumulation in the periplasmic space under varying osmotic conditions

  • Membrane Protein Analysis:

    • Detergent optimization for solubilization of inner membrane proteins

    • Specific considerations for transmembrane domain preservation during extraction

    • Blue-native PAGE for studying protein complexes in the inner membrane

  • Genetic Manipulation:

    • Conjugation-based methods for introducing foreign DNA

    • Broad-host-range vectors for complementation studies

    • Transposon mutagenesis strategies as demonstrated in the identification of opgC

Experimental Considerations for Gram-Positive Bacteria:

  • Cell Wall Considerations:

    • Modified extraction protocols to overcome thick peptidoglycan layer

    • Cell wall degradation enzymes (lysozyme, mutanolysin) required for efficient lysis

    • Alternative localization of glucans (cell wall-associated rather than periplasmic)

  • Protein Localization:

    • Focus on cytoplasmic membrane association without periplasmic space

    • Different membrane composition affecting protein extraction and purification

    • Modified protocols for membrane protein solubilization

  • Functional Analysis:

    • Different physiological roles of glucans in cell wall structure

    • Alternative osmoadaptation mechanisms predominating

    • Modified growth assays for phenotypic characterization

Comparative Analytical Methods:

  • Extraction and Analysis of Glucans:

    • Gram-negative: Osmotic shock extraction followed by TLC or HPLC analysis

    • Gram-positive: Harsh extraction methods (hot phenol or trichloroacetic acid) required

  • Protein Expression Systems:

    • Gram-negative: Traditional E. coli expression systems often suitable

    • Gram-positive: May require specialized expression hosts (B. subtilis, L. lactis)

These methodological distinctions reflect the fundamental differences in cell envelope architecture between Gram-negative and Gram-positive bacteria, necessitating adapted experimental approaches for studying opgH function across diverse bacterial species.

How do environmental factors influence opgH expression and function across different bacterial species?

Environmental factors exert significant and species-specific influences on opgH expression and function across different bacteria, reflecting their diverse ecological adaptations:

Osmolarity Effects:

The primary environmental factor affecting opgH expression is medium osmolarity, with low osmotic conditions strongly inducing expression in most Gram-negative bacteria. In R. sphaeroides, OPGs accumulate in large amounts in the periplasmic space specifically in response to low osmolarity . This response appears to be conserved across diverse bacterial species, though the magnitude and threshold of the response may vary.

Comparative Regulatory Mechanisms:

SpeciesOsmotic RegulationOther Environmental FactorsRegulatory Mechanisms
R. sphaeroidesStrong induction at low osmolarityPotentially influenced by light and oxygenOpgGIHC operon structure enables coordinated regulation
E. coliStrong induction at low osmolarityTemperature and growth phase effectsTwo-component regulatory systems; RpoS involvement
Other Gram-negative bacteriaVariable degree of osmotic regulationSpecies-specific environmental cuesDiverse regulatory mechanisms including two-component systems

Additional Environmental Modulators:

  • Carbon Source: Availability of UDP-glucose precursors influences opgH function, with carbon source affecting both expression and enzymatic activity.

  • Temperature: Temperature fluctuations affect membrane fluidity, which may influence the activity of membrane-associated opgH protein and its interaction partners.

  • pH: Environmental pH can affect protein conformation and enzymatic activity, with pH optima potentially varying between species.

  • Growth Phase: Expression patterns may vary with growth phase, with potential integration into quorum sensing networks in some species.

  • Host-Associated Signals: For pathogenic and symbiotic bacteria, host-derived signals may modulate opgH expression, as pathogenicity of many pathogens is lost by knocking out OPG-related genes .

Physiological Consequences:

The environmental modulation of opgH expression and function has direct consequences for bacterial physiology:

  • Environmental osmolarity affects OPG production, which in turn influences periplasmic osmolarity and cell turgor

  • Changes in OPG production impact bacterial adaptation to environmental stresses

  • In pathogens and symbionts, altered OPG production affects host interactions

This environmental responsiveness highlights the central role of opgH in bacterial adaptation to changing ecological conditions across diverse bacterial species.

What role does opgH play in bacterial pathogenicity and host-pathogen interactions?

The opgH gene and its encoded glucosyltransferase play significant roles in bacterial pathogenicity and host-pathogen interactions through multiple mechanisms:

Virulence Determination:
Recent research has demonstrated that pathogenicity of numerous bacterial pathogens is severely compromised or completely lost when OPG-associated genes, including opgH homologs, are knocked out . This virulence attenuation has been observed in diverse pathogens including Xanthomonas campestris, Agrobacterium tumefaciens, and Salmonella enterica serovar Typhimurium, highlighting the conserved importance of OPGs in pathogenicity regardless of whether the organism infects plants or animals .

Mechanisms of Virulence Contribution:

  • Osmoadaptation During Infection:

    • OPGs help bacteria adapt to changing osmotic environments encountered during infection

    • This adaptation is critical for bacterial survival in different host tissues and compartments

    • Mutants lacking functional opgH may exhibit reduced fitness in specific host niches

  • Host Recognition and Adhesion:

    • OPGs may serve as molecular patterns recognized by host receptors

    • These interactions can influence initial colonization and adhesion processes

    • The specific structure of OPGs, determined partially by opgH activity, may affect host recognition patterns

  • Immune Modulation:

    • OPGs can interact with host immune components, potentially modulating inflammatory responses

    • The specific chemical modifications of OPGs, influenced by the opgGIHC operon, may affect their immunomodulatory properties

    • Variation in OPG structure between bacterial species may contribute to differential host responses

  • Biofilm Formation:

    • OPGs contribute to biofilm matrix formation in some pathogens

    • Biofilms enhance bacterial resistance to host defenses and antimicrobials

    • OpgH activity influences the production of glucans that may serve as structural components in biofilms

Species-Specific Pathogenicity Roles:
While the importance of opgH in pathogenicity is conserved across many species, the specific mechanisms appear to vary. For example, in plant-associated bacteria like Rhizobiaceae, OPGs serve as symbiotic factors , whereas in animal pathogens, they may play different roles in host interaction and immune evasion.

Understanding these pathogenicity-related functions of opgH provides potential targets for antimicrobial development and strategies for attenuating bacterial virulence.

How can researchers evaluate the impact of opgH mutations on bacterial virulence in appropriate infection models?

Evaluating the impact of opgH mutations on bacterial virulence requires carefully designed infection models and multifaceted analytical approaches:

Selection of Appropriate Infection Models:

  • For Plant Pathogens (e.g., Xanthomonas, Agrobacterium):

    • Whole plant infection assays with quantitative disease scoring

    • Leaf infiltration models with measurement of bacterial growth kinetics

    • Seedling assays for evaluating early infection events

  • For Animal Pathogens (e.g., Salmonella):

    • Cell culture invasion/adhesion assays

    • Insect models (Galleria mellonella, Drosophila) for initial virulence screening

    • Murine models for systemic infection assessment

    • Specialized models reflecting the natural infection route

  • For Environmental/Opportunistic Pathogens:

    • Combined models assessing both environmental persistence and host interaction

    • Biofilm formation assays on abiotic and biotic surfaces

Experimental Design Considerations:

  • Genetic Construction:

    • Create clean deletion mutants of opgH using allelic exchange or CRISPR-Cas9

    • Generate complemented strains to confirm phenotype specificity

    • Create point mutations in catalytic domains to distinguish enzymatic activity from structural roles

  • Controlled Variables:

    • Standardize inoculum preparation and dosing

    • Control for growth defects by normalizing infection dose

    • Include multiple timepoints to distinguish between infection stages

  • Comprehensive Phenotypic Analysis:

    • Colonization: Quantitative recovery of bacteria from infected tissues

    • Persistence: Time-course analysis of bacterial survival in host

    • Tissue damage: Histopathological assessment of host tissues

    • Host response: Measurement of immune markers and signaling pathways

Advanced Analytical Methods:

  • In vivo Imaging:

    • Bioluminescent or fluorescent bacterial reporters for real-time tracking

    • Dual-reporter systems to monitor both bacterial distribution and host responses

  • Transcriptomic Analysis:

    • RNA-seq of bacteria recovered from infection sites

    • Dual RNA-seq to simultaneously analyze host and pathogen transcriptomes

  • Metabolomic Analysis:

    • Quantification of OPGs in infected tissues

    • Assessment of metabolic adaptations during infection

  • Structural Analysis:

    • Examination of OPG structural changes in vivo compared to in vitro

    • Correlation of structural modifications with virulence phenotypes

This comprehensive approach enables researchers to thoroughly evaluate the specific contributions of opgH to bacterial virulence, distinguishing direct virulence effects from indirect consequences of impaired physiological adaptation.

What are the potential biotechnological applications of recombinant opgH enzymes in glycobiology research?

Recombinant opgH enzymes offer significant potential for diverse biotechnological applications in glycobiology research and beyond:

Enzymatic Synthesis of Novel Oligosaccharides:

Recombinant opgH can be harnessed as a biocatalyst for the controlled synthesis of defined oligosaccharides and glycoconjugates. The enzyme's ability to catalyze the transfer of glucose residues from UDP-glucose donors to acceptor molecules can be exploited to:

  • Synthesize structurally defined β-glucan oligosaccharides with precise linkages

  • Generate libraries of glycan structures for glycobiology research

  • Produce specialized oligosaccharides as analytical standards for glycomics

  • Create novel glycoconjugates with potential applications in drug delivery and vaccine development

Glycoengineering Applications:

  • Pathway Reconstruction:

    • Assembly of complete OPG synthesis pathways in heterologous hosts

    • Engineering optimized pathways for industrial production of specialized glucans

    • Creation of synthetic bacterial strains with enhanced stress resistance

  • Enzyme Engineering:

    • Structure-guided modification of opgH substrate specificity

    • Development of thermostable or solvent-tolerant variants

    • Creation of chimeric enzymes with novel catalytic properties by domain swapping between homologs

Analytical Tools for Glycobiology:

  • Biosensor Development:

    • Enzyme-based sensors for UDP-glucose or related metabolites

    • Detection systems for monitoring bacterial adaptation to osmotic stress

  • Glycan Analysis:

    • Enzymatic sequencing of complex β-glucans

    • Specific labeling of glucan structures for analytical applications

Biomedical Applications:

  • Antimicrobial Development:

    • Target-based screening for opgH inhibitors as novel antimicrobials

    • Development of antivirulence compounds that disrupt OPG synthesis without affecting growth

  • Immunomodulation:

    • Production of defined OPG structures for studying host-microbe interactions

    • Development of adjuvants or immunomodulators based on OPG structures

Industrial Enzyme Applications:

Optimized recombinant opgH variants could potentially be employed in industrial processes requiring specific glycosidic bond formation, including:

  • Food technology applications

  • Modification of natural polysaccharides for improved properties

  • Green chemistry approaches for specialized oligosaccharide synthesis

These diverse applications highlight the significant biotechnological potential of recombinant opgH enzymes beyond their primary biological roles in bacterial osmoadaptation.

How can high-throughput screening approaches be optimized for identifying modulators of opgH activity?

Optimizing high-throughput screening (HTS) approaches for identifying modulators of opgH activity requires specialized strategies that address the unique challenges presented by this membrane-associated glucosyltransferase:

Assay Development Considerations:

  • Primary Screening Assays:

    Assay TypePrincipleAdvantagesLimitations
    Coupled Enzymatic AssayDetection of UDP release via coupling enzymes and NADH consumptionReal-time monitoring; adaptable to 384-well formatPotential for false positives from coupling enzyme inhibition
    Fluorescence-based AssayFRET-labeled substrates or acceptorsHigh sensitivity; reduced interferenceComplex substrate synthesis required
    Bioluminescence UDP DetectionADP detection using kinase and luciferase couplingExtremely sensitive; low backgroundMulti-enzyme system with potential for interference
    Whole-cell Reporter AssayopgH-dependent reporter expressionIdentifies compounds that work in cellular contextLower throughput; indirect readout
  • Counter-screening Strategies:

    • Parallel screening against related enzymes to identify selective inhibitors

    • Secondary assays using alternative detection methods to eliminate false positives

    • Detergent sensitivity assays to eliminate promiscuous aggregating compounds

Membrane Protein HTS Optimization:

  • Protein Preparation Strategies:

    • Detergent-solubilized membrane protein preparation

    • Reconstitution into nanodiscs or liposomes for native-like environment

    • Development of truncated soluble constructs retaining catalytic activity

  • Assay Stabilization:

    • Optimization of detergent type and concentration

    • Addition of lipids to maintain protein stability

    • Buffer composition optimization for long-term stability at room temperature

Compound Library Considerations:

  • Library Design:

    • Fragment-based approaches for targeting catalytic sites

    • Natural product libraries enriched for carbohydrate-mimetic structures

    • Focused libraries based on UDP-glucose analogs

    • Diversity-oriented synthesis collections for novel chemical scaffolds

  • Compound Management:

    • Careful assessment of compound solubility in detergent-containing buffers

    • Evaluation of potential micelle partitioning effects

    • Counter-screens for membrane-disruptive compounds

Advanced Screening Technologies:

  • Microfluidic Approaches:

    • Droplet-based microfluidics for ultra-miniaturized assays

    • Microfluidic diffusion analysis for detecting binding without activity requirements

  • Label-free Technologies:

    • Surface plasmon resonance (SPR) for direct binding detection

    • Thermal shift assays adapted for membrane proteins

    • Mass spectrometry-based screening for direct product detection

  • Computational Pre-screening:

    • Virtual screening against homology models or crystal structures

    • Pharmacophore-based filtering of compound libraries

    • Machine learning approaches to predict activity based on training sets

These optimized HTS approaches enable efficient identification of both inhibitors and activators of opgH activity, with applications in antimicrobial development and fundamental glycobiology research.

What emerging technologies and approaches might accelerate our understanding of opgH function and regulation?

Several emerging technologies and innovative approaches show exceptional promise for advancing our understanding of opgH function and regulation:

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy:

    • Single-particle cryo-EM for high-resolution structure determination of membrane-embedded opgH

    • Visualization of opgH within larger multiprotein complexes with OpgG and OpgI

    • Structural analysis of conformational changes during catalytic cycles

  • Integrative Structural Biology:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics

    • Crosslinking mass spectrometry to define protein-protein interaction interfaces

Genetic and Genomic Technologies:

  • CRISPR Interference and Activation:

    • CRISPRi for fine-tuned knockdown of opgH expression

    • CRISPRa for controlled overexpression studies

    • Multiplexed CRISPR screening to identify genetic interactions

  • Single-Cell Approaches:

    • Single-cell RNA-seq to analyze heterogeneity in opgH expression

    • Time-lapse microscopy with fluorescent reporters to track dynamic regulation

    • Microfluidic platforms for manipulating osmotic environments with high temporal resolution

Advanced Imaging Technologies:

  • Super-Resolution Microscopy:

    • PALM/STORM imaging of fluorescently tagged opgH to visualize membrane localization

    • Multi-color super-resolution imaging to analyze co-localization with interaction partners

    • Lattice light-sheet microscopy for dynamic processes in living cells

  • Correlative Light and Electron Microscopy (CLEM):

    • Combining fluorescence microscopy with electron microscopy

    • Visualization of opgH localization in relation to membrane architecture

    • Immunogold labeling for precise localization at ultrastructural level

Systems Biology Approaches:

  • Multi-omics Integration:

    • Combined transcriptomics, proteomics, and metabolomics analysis

    • Network modeling of osmotic stress responses

    • Machine learning approaches to identify regulatory patterns

  • Biosensors for Real-time Analysis:

    • FRET-based biosensors for UDP-glucose fluctuations

    • Genetically encoded sensors for osmotic changes

    • Real-time monitoring of opgH activity in vivo

Synthetic Biology Strategies:

  • Minimal Cell Approaches:

    • Reconstruction of OPG synthesis machinery in minimal cells

    • Bottom-up assembly of functional modules

    • Quantitative analysis of system behavior with defined components

  • Orthogonal Translation Systems:

    • Site-specific incorporation of non-canonical amino acids for precise functional studies

    • Photo-crosslinking to map transient interactions

    • Click chemistry labeling for visualization and analysis

These emerging technologies, particularly when applied in combination, have the potential to dramatically accelerate our understanding of opgH function, regulation, and integration into bacterial physiology.

What are the key unresolved questions regarding opgH function that future research should address?

Despite significant advances in our understanding of opgH and its role in OPG synthesis, several critical questions remain unresolved and should be prioritized in future research:

Structural and Mechanistic Questions:

  • Catalytic Mechanism:

    • What is the precise catalytic mechanism of opgH-mediated glycosyl transfer?

    • How does opgH achieve regioselectivity for specific glycosidic linkages?

    • What determines the degree of polymerization and cyclization of the glucan products?

  • Protein-Protein Interactions:

    • How do OpgG, OpgI, and OpgH interact to form a functional complex?

    • What is the stoichiometry of the complex and the contribution of each component?

    • How are these interactions modulated by environmental conditions?

  • Membrane Integration:

    • How is opgH oriented and organized within the cytoplasmic membrane?

    • What membrane microdomains are associated with functional opgH complexes?

    • How does membrane composition affect opgH activity and regulation?

Regulatory Questions:

  • Transcriptional Regulation:

    • What are the transcription factors controlling opgH expression?

    • How is osmosensing coupled to transcriptional regulation of the opgGIHC operon?

    • What additional environmental signals modulate opgH expression?

  • Post-translational Regulation:

    • Is opgH subject to post-translational modifications?

    • How is opgH activity regulated in response to rapid osmotic fluctuations?

    • Are there protein-protein interactions that modulate its catalytic activity?

  • Coordination with Cellular Processes:

    • How is OPG synthesis coordinated with cell division and envelope biogenesis?

    • What are the temporal dynamics of opgH expression during adaptation to osmotic changes?

    • How is opgH activity integrated with central carbon metabolism and UDP-glucose availability?

Physiological and Ecological Questions:

  • Beyond Osmoadaptation:

    • What additional physiological roles do opgH and OPGs play beyond osmoadaptation?

    • How do these functions vary across different bacterial species and ecological niches?

    • What is the energetic cost of OPG synthesis and how is it balanced against benefits?

  • Host Interaction Mechanisms:

    • What are the molecular mechanisms by which OPGs influence host-pathogen interactions?

    • How do specific structural features of OPGs, determined by opgH activity, affect these interactions?

    • Can OPG production be targeted as an antivirulence strategy?

  • Evolutionary Questions:

    • What evolutionary pressures have shaped the diversification of opgH across bacterial lineages?

    • How has horizontal gene transfer contributed to the distribution of different OPG synthesis systems?

    • What selective advantages have maintained these systems throughout bacterial evolution?

Addressing these unresolved questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, systems biology, and evolutionary analysis to fully elucidate the multifaceted roles of opgH in bacterial physiology and ecology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.