Recombinant Rhodobacter sphaeroides L-alanine exporter AlaE (alaE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhodobacter sphaeroides L-Alanine Exporter AlaE (alaE)

The recombinant Rhodobacter sphaeroides L-alanine exporter AlaE (alaE) is a protein expressed in Escherichia coli and derived from the bacterium Rhodobacter sphaeroides. This protein is specifically designed to export L-alanine, an amino acid crucial for various cellular processes. The recombinant form of AlaE is engineered with an N-terminal His tag, facilitating its purification and identification.

Characteristics of Recombinant AlaE

  • Protein Details: The recombinant AlaE protein consists of 135 amino acids (1-135aa) and is fused with an N-terminal His tag for easy purification and detection .

  • Expression Host: It is expressed in E. coli, a common host for recombinant protein production due to its well-understood genetics and efficient expression systems .

  • Purity and Storage: The protein is available in a lyophilized form with a purity of greater than 90% as determined by SDS-PAGE. It should be stored at -20°C or -80°C to maintain stability .

Function and Role of AlaE

AlaE functions as an exporter of L-alanine, helping to regulate intracellular levels of this amino acid. In bacteria like Escherichia coli, L-alanine exporters play a critical role in preventing toxic accumulation of L-alanine and its derivatives, which can inhibit cell growth .

Research Findings

While specific research on the Rhodobacter sphaeroides AlaE is limited, studies on similar L-alanine exporters in other bacteria provide valuable insights. For instance, the AlaE exporter in E. coli is crucial for maintaining intracellular L-alanine homeostasis and acts as a safety valve under conditions of high L-alanine levels .

Comparison with Other L-Alanine Exporters

ExporterOrganismFunctionRegulation
AlaERhodobacter sphaeroidesL-alanine exportNot specified
AlaEEscherichia coliL-alanine export, prevents toxic accumulationRegulated by Lrp in response to L-alanine and L-leucine
ygaWEscherichia coliL-alanine export, complements hypersensitivity to dipeptidesInducible

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
alaE; RHOS4_36940; RSP_3651; L-alanine exporter AlaE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Target Names
alaE
Target Protein Sequence
MRLFIIDTVATVIFFTAVATFSELLIAGMAPSEVLATRLLMVPVMVLTGRPYTRWRDWLV RRTAPRNRWSAFLTDILAFLSFQAPVYGATLLIAGASFAEAGTAIGSAIILMILLARPFG LFVEWTRSLFGVELS
Uniprot No.

Target Background

Function
Exports L-alanine.
Database Links
Protein Families
AlaE exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.