Recombinant Rhodobacter sphaeroides Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC Protein

YidC protein from Rhodobacter sphaeroides functions as a membrane protein insertase, playing a vital role in integrating proteins into bacterial membranes. It belongs to the evolutionarily conserved YidC/Oxa1/Alb3 protein family, with homologs present across bacteria, mitochondria, and chloroplasts . R. sphaeroides, as a photosynthetic purple bacterium with abundant intracytoplasmic membranes, utilizes YidC for critical membrane protein assembly processes necessary for photosynthetic function .

The membrane protein insertase YidC is also known by several alternative names including Foldase YidC, Membrane integrase YidC, and Membrane protein YidC . This multifunctional protein serves as an essential component in membrane biogenesis pathways, particularly in organisms with complex internal membrane structures like R. sphaeroides.

Functional Mechanism of YidC

As a membrane protein insertase, YidC facilitates the integration and proper folding of membrane proteins into the lipid bilayer. This function is particularly critical in R. sphaeroides, which possesses extensive intracytoplasmic membranes important for photosynthesis .

Membrane Protein Insertion Activity

YidC functions by recognizing and interacting with nascent membrane proteins, guiding their insertion into the membrane in the correct orientation and facilitating proper folding . Unlike the more complex Sec translocon, YidC can operate independently for certain substrate proteins, providing an alternative pathway for membrane protein biogenesis .

In R. sphaeroides, YidC plays a crucial role in the assembly of photosynthetic complexes, associating with reaction centers, bacteriochlorophyll synthase (BchG), and other membrane assembly components including the protein translocase subunit YajC and the SecYEG-SecDF-YajC-YidC assembly machinery . This coordinated interaction ensures efficient delivery of pigments and insertion of light-harvesting polypeptides during photosynthetic complex formation .

C-terminal Domain Functionality

Research on the C-terminal domain of R. sphaeroides YidC has revealed critical insights into its function. A study published in 2015 demonstrated that the last five residues (619-623, "KKRKP") of the protein are important, but interestingly, individual mutations of these residues did not abolish function . The deletion of all five C-terminal residues prevented complementation of YidC function in E. coli, while deletion of only the last four residues still allowed functional activity .

Role in Photosynthetic Membrane Assembly

R. sphaeroides is a photosynthetic bacterium with complex intracytoplasmic membrane structures housing the photosynthetic apparatus. YidC plays a central role in establishing this specialized membrane architecture .

Intracytoplasmic Membrane Development

In R. sphaeroides, YidC participates in the formation of intracytoplasmic membrane vesicles called chromatophores, which contain the photosynthetic complexes . These vesicles number between 200-300 per cell under high-light conditions but can increase to approximately 1500 under low-light intensity . YidC's function in membrane protein insertion is critical for the proper assembly of these structures.

Interaction with Photosynthetic Complexes

Research has demonstrated that YidC associates with key components of the photosynthetic machinery in R. sphaeroides . It forms oligomers at sites of membrane invagination initiation and interacts with:

  1. Reaction centers (RCs)

  2. Bacteriochlorophyll synthase (BchG)

  3. Protein translocase subunit YajC

  4. YidC membrane protein insertase assembly components

These associations create specialized membrane nanodomains that maximize interactions between newly synthesized pigments and nascent proteins, coordinating the co-translational insertion, folding, and assembly of photosynthetic complexes . This organization is particularly important for the efficient assembly of light-harvesting complexes like LH1 and LH2, which require precise integration of both protein and pigment components .

Expression and Purification

Recombinant production of R. sphaeroides YidC employs E. coli expression systems for efficient protein yield and purification .

Expression Methods

The expression of recombinant R. sphaeroides YidC typically involves:

  1. Cloning the yidC gene into suitable expression vectors

  2. Transformation into E. coli host strains

  3. Induction of protein expression under optimized conditions

  4. Extraction and solubilization of the membrane-associated protein

Purification Techniques

Purification of recombinant YidC often utilizes affinity chromatography techniques, taking advantage of the His-tag or other affinity tags fused to the protein . The purified protein can be obtained with greater than 90% purity as determined by SDS-PAGE analysis .

After purification, the protein is typically supplied in either lyophilized form or in a storage buffer containing Tris/PBS-based buffer with 6% Trehalose (pH 8.0) or other optimized formulations . For long-term storage, addition of 5-50% glycerol (with 50% being common) and storage at -20°C/-80°C is recommended, with aliquoting to avoid repeated freeze-thaw cycles .

Research Applications

Recombinant R. sphaeroides YidC serves multiple research applications:

  1. Structural studies of membrane protein insertases

  2. Functional analysis of membrane protein biogenesis

  3. Investigation of photosynthetic complex assembly

  4. Comparative studies with YidC homologs from other organisms

  5. Development of antibodies against specific YidC epitopes

The protein is particularly valuable for understanding the mechanisms of membrane protein insertion and the specialized adaptations in photosynthetic bacteria like R. sphaeroides.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill your requirement whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol includes a final glycerol concentration of 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquot the protein. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please let us know and we will prioritize its development for your request.
Synonyms
yidC; Rsph17029_2725; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-623
Protein Length
full length protein
Species
Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Target Names
yidC
Target Protein Sequence
MDDQNKNLILATGLSFLVIMVWFFLFPPPEAVTEGETTVATQQTAVAPSATPDAPTTAVP PDAELPETQRVVIDTPRLQGSISMLGGRLDDLSLKSYHETLDPQSQIVRLLSPVGQPNAY YALYGWTPAGALGYEDVPGANTTWTQVGSGALGVDQPVTLQWDNGKGLVFTRTISVDDHY MFSVAQTVENNSGQAVQLAPYGIVARHGKPLNLQNFFVLHEGVVGRADGKLTETKYDKVA ELPQVAREGAQAEVIDAQQDGWIGFTDKYWMTTLIPQQGQPFTSVTKYVPGADIYQAETR EQLVTVAPGATAEVSSRLFAGAKEWETIRAYQNEGATEPTEGAEPIPGFIDSIDWGWFFF LTKPIFTVLHWLNHMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPELEALRE RAGDDKMLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHAPFFGWL KDLSAPDPSSIFNFFGLAPWAAPTPGTTMALIFIGALPILLGVSMWLQQKLNPAPGDKAQ AMIFAWMPWVFMFMLGHFASGLVLYWIVNNLITFTQQYVIMRSHGHHPDIFGNIKASFSR KPAAQPAGKAANDGAAPAKKRKP
Uniprot No.

Target Background

Function
YidC is crucial for the insertion and proper folding of integral membrane proteins into the membrane. It facilitates the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, and is also involved in the insertion of at least some lipoproteins. YidC plays a key role in aiding the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in bacterial cells?

YidC is a membrane protein insertase that plays a crucial role in the integration of newly synthesized proteins into the bacterial membrane. It belongs to a conserved family of membrane protein biogenesis factors that includes the mitochondrial Oxa1 and chloroplast Alb3 proteins. In bacteria like Rhodobacter sphaeroides, YidC functions to facilitate the proper insertion and folding of membrane proteins, particularly those with transmembrane domains . The protein operates through a hydrophobic slide consisting primarily of transmembrane segments TM3 and TM5, which guides client proteins into the lipid bilayer .

Why is Rhodobacter sphaeroides particularly valuable for YidC research?

Rhodobacter sphaeroides offers unique advantages for studying membrane proteins like YidC because it contains abundant intracytoplasmic membranes . This photosynthetic bacterium provides significantly more membrane surface area per cell compared to other typical expression hosts, making it particularly suitable for the overexpression and functional characterization of membrane proteins . The expanded membrane system in R. sphaeroides creates an ideal environment for studying membrane protein insertion mechanisms and for producing recombinant membrane proteins for structural and functional studies.

How does the structure of YidC relate to its function?

The conserved membrane-integrated core of YidC forms a helical bundle arranged like a pentagon, in the order 4-5-3-2-6 (clockwise) when viewed from the cytoplasm . This structural arrangement creates a hydrophobic slide composed primarily of TM3 and TM5 that serves as the main functional element for guiding newly synthesized membrane proteins into the lipid bilayer . The protein core is stabilized through both short and long-range interactions between the five helices, with polar or charged residues toward the cytoplasmic side engaged in electrostatic interactions, while aromatic residues on the periplasmic side participate in stacking and nonpolar dispersion interactions . This precise structural organization enables YidC to properly orient and insert client proteins into the membrane.

What are the key functional domains of YidC to consider when designing recombinant constructs?

When designing recombinant YidC constructs, several key domains must be considered:

  • Transmembrane Core: The five conserved transmembrane helices (TM2-TM6) form the functional core required for membrane insertion activity .

  • C-terminus: The C-terminal region, particularly the presence of an amino acid at position 619 in R. sphaeroides YidC, is critical for function. Research shows the length of this region is more important than its exact amino acid composition .

  • Helical Paddle Domain (HPD): This cytoplasmic loop between TM2 and TM3 forms a helical hairpin that interacts with lipid headgroups and contributes to protein stability .

  • C2 Loop: This region plays a crucial role in conformational dynamics and affects functionally essential areas of gram-negative YidC .

  • Ribosome Binding Sites: Residues like Y370, Y377, and D488 interact with the ribosome during co-translational membrane protein insertion .

When creating recombinant constructs, it's important to preserve these domains to maintain functionality, while tags or modifications should be positioned to avoid disrupting these critical regions.

What are the optimal expression conditions for producing functional recombinant R. sphaeroides YidC?

Optimal expression of functional recombinant R. sphaeroides YidC requires careful consideration of several factors:

Expression System Selection:

  • R. sphaeroides itself serves as an excellent host due to its expanded intracytoplasmic membrane system .

  • For heterologous expression, E. coli can be used with a modular approach similar to that employed for the SecYEG-SecDFYajC-YidC holotranslocon .

Promoter Selection:

  • When using R. sphaeroides as host, the moderately strong and highly regulated superoperonic photosynthetic promoter pufQ has been demonstrated to be effective for membrane protein expression .

  • This provides controlled expression that can be induced under specific conditions.

Growth Conditions:

  • For photosynthetic bacteria like R. sphaeroides, light intensity and oxygen levels must be carefully controlled.

  • Growth under low-oxygen or anaerobic conditions with appropriate light exposure promotes intracytoplasmic membrane development, enhancing yields of membrane proteins.

Purification Strategy:

  • Gentle detergent solubilization with mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) preserves protein structure and function.

  • Affinity purification using carefully positioned tags that don't interfere with critical domains is recommended.

The expression process should be monitored at each stage for protein stability and functional activity to ensure the recombinant YidC retains its native conformation and insertion capabilities.

How can mutations in the C-terminus of YidC be designed to study functional impacts?

Designing mutations in the C-terminus of YidC requires strategic approaches based on current understanding of structure-function relationships:

Deletion Analysis Approach:
Research on R. sphaeroides YidC has revealed that the last 5 residues (619-623, KKRKP) are important for function, with the presence of an amino acid at position 619 being particularly critical . To study functional impacts:

  • Create targeted deletion mutants:

    • Last 5 residues deletion (Δ619-623)

    • Last 4 residues deletion (Δ620-623)

    • Last 3 residues deletion (Δ621-623)

    • Single residue deletions

  • Design substitution mutations:

    • Charge-preserving mutations (e.g., K619R)

    • Charge-reversing mutations (e.g., K619E)

    • Hydrophobic substitutions (e.g., K619A or K619L)

    • Position-619 substitutions with various amino acids to test specific properties

Functional Assessment Methods:

  • Complement growth of E. coli YidC gene depletion strain FTL10 as described in previous studies

  • Measure insertion efficiency of known YidC substrates such as subunit a of FoF1 ATP synthase

  • Assess interaction with other components of the translocation machinery like SecY

Analysis Table for C-terminal Mutations:

Mutation TypeExampleExpected Functional ImpactComplementation in FTL10
Complete deletion (Δ619-623)KKRKP→ΔLoss of functionNo
Partial deletion (Δ620-623)KKRKP→KPartially functionalYes, reduced
Position 619 substitutionK619AFunctional if residue presentYes
Charge neutralizationK619A, R621A, K622AFunctional (length more important than charge)Yes

This systematic approach allows for detailed structure-function analysis of the C-terminus in YidC activity.

What methods can be used to assess the interaction between YidC and client proteins during membrane insertion?

Several advanced techniques can be employed to study YidC-client protein interactions:

Disulfide Crosslinking:
Introduce single cysteine residues at specific positions in both YidC and the client protein. Upon exposure to oxidizing agents like DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)), disulfide bonds form between closely positioned cysteines, which can be detected by SDS-PAGE and immunoblotting. This approach has successfully demonstrated that client proteins interact primarily with TM3 of YidC during insertion .

Experimental Protocol:

  • Create single cysteine mutants in TM3 (e.g., M430C, P431C) and TM5 (e.g., V500C, T503C) of YidC

  • Create cysteine mutants in transmembrane regions of client proteins

  • Reconstitute with ribosome-nascent chain complexes (RNCs)

  • Expose to oxidizing agent DTNB

  • Analyze crosslinked products by SDS-PAGE and immunoblotting with antibodies against both YidC and the client protein

Cryo-Electron Microscopy:
Cryo-EM has been successfully used to visualize the interaction between YidC and ribosomes during co-translational insertion. This technique provides structural information about how YidC positions itself relative to the ribosome exit tunnel and the inserting nascent chain .

Fluorescence Resonance Energy Transfer (FRET):
Label YidC and client proteins with fluorescent donor-acceptor pairs to monitor real-time interactions during the insertion process. This allows for dynamic assessment of protein-protein proximity during the insertion reaction.

Site-Directed Photo-crosslinking:
Incorporate photoreactive amino acid analogs at specific positions in YidC or client proteins, which can be activated by UV light to form covalent bonds with nearby molecules, enabling precise mapping of interaction interfaces.

How can molecular dynamics simulations be integrated with experimental data to study YidC function?

Integrating molecular dynamics (MD) simulations with experimental data provides powerful insights into YidC function:

Simulation Protocol Design:

  • Build an initial structural model based on evolutionary co-variation analysis and predicted lipid/protein exposure

  • Embed the model in a representative bacterial membrane (e.g., 3:1 POPE:POPG lipid composition)

  • Solvate the system and add counterions to neutralize the system

  • Perform equilibration followed by production MD simulations (100+ ns)

Key Analysis Parameters:

  • Stability of transmembrane helices

  • Flexibility of loop regions, especially the C2 loop and helical paddle domain

  • Interaction energies between specific residues

  • Hydrogen bond networks

  • Membrane thickness changes around the protein

Integration with Experimental Data:
MD simulations identified residues T362 in TM2 and Y517 in TM6 as critical for stability. When these residues were mutated to alanine in experimental studies, YidC was indeed functionally inactivated despite being stably expressed . This validates the predictive power of the simulations.

Workflow for MD-Experiment Integration:

  • Computational Prediction: Identify key stabilizing residues through MD (e.g., T362, Y517)

  • Experimental Validation: Create alanine mutants and test in complementation assays

  • Refinement: Update the model based on experimental results

  • New Predictions: Use the refined model to predict additional functional features

  • Iterative Cycle: Continue the prediction-validation cycle

This integrative approach has successfully identified residues critical for YidC stability and function, demonstrating its value for structure-function studies .

How does YidC functionally interact with the Sec translocon machinery?

YidC and the Sec translocon (SecYEG) represent two major pathways for membrane protein insertion in bacteria, with evidence of both independent operation and functional cooperation:

Independent Functions:
YidC can insert certain membrane proteins, such as the M13 procoat protein and C-tail protein SciP, in a Sec-independent manner . These proteins typically have shorter translocated domains and simpler membrane topologies.

Cooperative Interactions:
For more complex membrane proteins, YidC works with the Sec machinery in several ways:

  • YidC-SecYEG Interaction: Direct contact between YidC and SecY has been observed. A quintuple mutation in YidC (YidC-5S) was shown to inhibit this interaction .

  • Sequential Handoff: Some proteins are initially engaged by the SecYEG translocon and then transferred to YidC for proper folding and membrane integration.

  • Holotranslocon Formation: YidC can associate with SecYEG and additional components (SecDF, YajC) to form a larger complex called the holotranslocon (HTL) . This complex provides an integrated platform for protein translocation and membrane insertion.

Experimental Evidence:
When purified fluorescently labeled YidC and SecYEG were co-reconstituted in proteoliposomes, wild-type YidC approached SecYEG, while the YidC-5S mutant did not . This provides direct evidence for physical interaction between these components.

Functional Implications:
The interaction between YidC and the Sec machinery is particularly important for the insertion of complex polytopic membrane proteins and those with large periplasmic domains that require both translocation across and insertion into the membrane.

What is the role of YidC in ribosome binding during co-translational membrane protein insertion?

YidC plays a critical role in co-translational membrane protein insertion through direct interactions with the ribosome:

Ribosome Binding Interface:
Molecular modeling and cryo-electron microscopy studies have identified specific regions of YidC that contact the ribosome :

  • Residues Y370 and Y377 contact ribosomal RNA helix 59

  • Residue D488 interacts with ribosomal protein uL23

  • These residues are located near the ribosomal exit tunnel, positioning YidC optimally to receive nascent membrane proteins

Functional Significance:
Mutation of these key residues (Y370A, Y377A, and D488K) severely interferes with YidC activity in vivo . This demonstrates that the ribosome binding interface is critical for YidC function.

Nascent Chain Interaction:
During co-translational insertion, the transmembrane domain of the nascent chain interacts specifically with TM3 of YidC, as demonstrated by disulfide crosslinking experiments . This positions the inserting protein for proper integration into the membrane.

Proposed Insertion Mechanism:

  • The ribosome-nascent chain complex docks to YidC through specific interactions

  • The nascent membrane protein emerges from the ribosome exit tunnel

  • The transmembrane segment of the nascent protein contacts TM3 of YidC

  • YidC guides the TM segment through its hydrophobic slide (TM3-TM5) into the lipid bilayer

  • Proper folding and membrane integration are facilitated by YidC

This co-translational insertion mechanism ensures efficient and accurate integration of membrane proteins directly from the ribosome.

What are the critical residues for YidC function identified through mutational analysis?

Several critical residues have been identified that are essential for YidC function:

Transmembrane Core Residues:

  • T362 in TM2 and Y517 in TM6: Located at the same height in the membrane, these residues completely inactivate YidC when mutated to alanine, despite the protein being stably expressed . These residues appear to be critical for the stability of the TM helical bundle.

  • F433, M471, and F505: Mutations of these residues show intermediate activity levels, suggesting they play supporting roles in YidC function .

Ribosome Binding Interface:

  • Y370 and Y377: These residues contact ribosomal RNA helix 59 and are essential for YidC activity .

  • D488: This residue interacts with ribosomal protein uL23 and is critical for ribosome binding and YidC function .

C-terminal Region:

  • Residue at Position 619: In R. sphaeroides YidC, the presence of an amino acid at position 619 is essential for function, although the specific amino acid identity appears less important than its presence .

Experimental Data Table of Critical Residues:

ResidueLocationMutationFunctional EffectProposed Role
T362TM2T362AComplete loss of functionCore stabilization
Y517TM6Y517AComplete loss of functionCore stabilization
Y370CytoplasmicY370ASevere interferenceRibosome binding (rRNA H59)
Y377CytoplasmicY377ASevere interferenceRibosome binding (rRNA H59)
D488CytoplasmicD488KSevere interferenceRibosome binding (uL23)
Position 619C-terminusDeletionLoss of functionStructural integrity
F433/M471/F505Various TMsAla substitutionsIntermediate activitySupporting structure

This collection of critical residues provides a map of functionally important sites across the YidC structure and offers targets for further investigation into the mechanism of membrane protein insertion.

How does the C2 loop contribute to YidC conformational dynamics and function?

The C2 loop of YidC plays a crucial role in the protein's conformational dynamics and function:

Conformational Impact:
The absence of the C2 loop affects cross-correlation patterns between different transmembrane helices, particularly between TM1 and TM4 . This suggests that the C2 loop functions as a conformational regulator that influences the relative positioning and movement of the transmembrane domains.

Functional Implications:
The C2 loop affects the behavior of functionally essential areas of gram-negative YidC . While the exact mechanism remains to be fully elucidated, it appears that the C2 loop may:

  • Stabilize specific conformational states of YidC required for substrate binding or insertion

  • Modulate the dynamics of the transmembrane core to accommodate different client proteins

  • Potentially interact with other components of the translocation machinery

Experimental Approach to Study C2 Loop:
Researchers have used molecular dynamics simulations comparing wild-type YidC with C2 loop deletion variants to understand its role . These computational studies have been supported by DNA analysis confirming global and regional structural alterations in the absence of the C2 loop.

The findings highlight the importance of considering not just the transmembrane core but also connecting loops when studying YidC function and designing recombinant constructs. The C2 loop appears to be a key element in the allosteric regulation of YidC conformational dynamics.

How can R. sphaeroides YidC be optimized for heterologous membrane protein expression?

R. sphaeroides offers significant advantages for membrane protein expression due to its abundant intracytoplasmic membranes . Here are strategies to optimize this system:

Vector Design Optimization:

  • Promoter Selection: The superoperonic photosynthetic promoter pufQ has been successfully used for controlled expression of membrane proteins in R. sphaeroides . This promoter allows modulation of expression levels through light and oxygen conditions.

  • Signal Sequence Engineering: Incorporating native R. sphaeroides signal sequences can improve targeting to the intracytoplasmic membrane.

  • Fusion Partners: Strategic fusion partners that enhance folding or membrane targeting can be incorporated, with appropriate protease cleavage sites for tag removal.

Expression Conditions:

  • Light Regimes: Manipulating light intensity can fine-tune expression from photosynthetic promoters

  • Oxygen Levels: Microaerobic conditions promote intracytoplasmic membrane formation

  • Temperature: Lower temperatures (24-28°C) often improve proper folding of membrane proteins

  • Induction Protocols: Gradual induction strategies prevent overwhelming the membrane insertion machinery

Host Strain Engineering:

  • Developing R. sphaeroides strains with enhanced membrane capacity

  • Engineering strains with modified lipid composition to better accommodate heterologous proteins

  • Creating strains with additional copies of YidC or other insertion machinery components

Purification Strategy:

  • Gentle membrane solubilization protocols

  • Affinity tags positioned to avoid interference with protein function

  • Size-exclusion chromatography to isolate properly folded protein

Application Example:
This system has been successfully used for the expression of G protein-coupled receptors (GPCRs), including the human adenosine A2a receptor (A2aR), human angiotensin AT1a receptor (AT1aR), and human bradykinin B2 receptor (B2R) . Among these, AT1aR showed the highest expression level and was successfully solubilized and affinity-purified in a functional state.

What are the current challenges and future directions in understanding YidC-mediated membrane protein insertion?

Despite significant advances, several challenges and opportunities remain in YidC research:

Current Challenges:

  • Substrate Specificity: The molecular basis for YidC substrate recognition remains incompletely understood. Why are some proteins inserted by YidC alone while others require the Sec machinery?

  • Conformational Changes: The dynamic conformational changes that YidC undergoes during the insertion process have not been fully characterized.

  • Species-Specific Differences: R. sphaeroides YidC may function differently compared to its homologs in other species , but the molecular basis for these differences is not well defined.

  • Integration with Other Cellular Processes: How YidC-mediated insertion coordinates with other cellular processes like protein quality control remains to be elucidated.

Future Research Directions:

  • Time-Resolved Structural Studies: Employing techniques like time-resolved cryo-EM or single-molecule FRET to capture YidC in different stages of the insertion process.

  • Comprehensive Substrate Profiling: Systematic identification of YidC-dependent substrates across different bacterial species using techniques like ribosome profiling.

  • Synthetic Biology Approaches: Engineering YidC variants with altered substrate specificity or enhanced activity for biotechnological applications.

  • Systems Biology Integration: Understanding how YidC-mediated insertion fits into the broader network of membrane protein biogenesis and quality control.

  • Comparative Studies: Detailed comparison of YidC from different species, including R. sphaeroides, to understand species-specific adaptations and functions.

  • Therapeutic Targeting: As membrane protein insertion is essential for bacterial viability, YidC represents a potential antibiotic target. Structure-based drug design could lead to new antibacterial compounds.

These research directions will not only advance our fundamental understanding of membrane protein biogenesis but may also lead to biotechnological applications and new therapeutic strategies targeting bacterial membrane protein insertion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.