Recombinant Rhodobacter sphaeroides NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhodobacter sphaeroides NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Rhodobacter sphaeroides NADH-quinone oxidoreductase subunit K (nuoK) is a hydrophobic membrane protein component of the bacterial proton-translocating NADH-quinone oxidoreductase (NDH-1), a respiratory complex analogous to mitochondrial Complex I. This subunit is encoded by the nuoK gene within the nuo operon, which encodes the 14-subunit NDH-1 in Rhodobacter sphaeroides. Recombinant nuoK is typically expressed in Escherichia coli with an N-terminal His-tag for purification and functional studies .

Amino Acid Sequence and Expression

Recombinant nuoK spans 101 amino acids (1–101 aa) with a conserved sequence:
MVGLEHYLTVSAALLVIGIFGIFLNRKNVIVILMSIELmLLAVNINLVAFSSFLGDLTGQ VFTLFVLTVAAAEAAIGLAILVTFFRNRGTIDVEDVNVMKG .
Key features include:

  • Tag: N-terminal His-tag for affinity chromatography .

  • Expression System: E. coli .

  • Buffer: Tris-based buffer with 50% glycerol for stabilization .

FeatureValue
Length101 amino acids
Molecular Weight~11.5 kDa (estimated from sequence)
TagN-terminal His-tag
Expression HostE. coli
Storage Conditions-20°C or -80°C (avoid repeated freeze-thaw cycles)

Conserved Residues and Interactions

Though nuoK lacks cofactors, its hydrophobic nature suggests roles in:

  • Membrane Anchoring: Interactions with other subunits (e.g., NuoA, NuoH) to maintain structural integrity .

  • Quinone Binding: Indirect support from studies on NuoD (quinone-binding cavity) and NuoH (cytoplasmic loops) .

Antibody-Based Assays

Recombinant nuoK is used in ELISA kits for detecting native or recombinant NDH-1 in Rhodobacter sphaeroides strains. These kits enable:

  • Protein Quantification: Measurement of nuoK levels in cell lysates or purified complexes .

  • Subunit-Specific Studies: Analysis of NDH-1 assembly defects or expression patterns under stress conditions .

Mutagenesis and Functional Studies

While no direct mutagenesis data on nuoK are available, analogous studies on other subunits (e.g., NuoC, NuoD) highlight the importance of conserved residues for enzyme activity . For example:

  • NuoC Mutants: Glu-138, Glu-140, and Asp-143 are critical for NDH-1 assembly and proton translocation .

  • NuoD Mutants: Gly217, Pro218, and Gly225 are essential for quinone binding and inhibitor sensitivity .

These findings suggest that nuoK’s hydrophobic residues may similarly stabilize NDH-1’s membrane domain.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
nuoK; Rsph17029_1188; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Target Names
nuoK
Target Protein Sequence
MVGLEHYLTVSAALLVIGIFGIFLNRKNVIVILMSIELMLLAVNINLVAFSSFLGDLTGQ VFTLFVLTVAAAEAAIGLAILVTFFRNRGTIDVEDVNVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the enzyme's immediate electron acceptor. The enzyme couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K in Rhodobacter sphaeroides metabolism?

The NADH-quinone oxidoreductase subunit K (nuoK) is a membrane-embedded component of Complex I in the respiratory chain of R. sphaeroides. This subunit contributes to the proton-pumping activity of the complex, which is crucial for energy generation. R. sphaeroides utilizes this complex differently depending on growth conditions (aerobic respiration, anaerobic respiration, or photosynthesis) . Under autotrophic conditions, when R. sphaeroides fixes CO₂, the regulation of electron transport becomes particularly important for balancing energy production and reactive oxygen species (ROS) generation . NADH-quinone oxidoreductase serves as a significant entry point for electrons into the respiratory chain, influencing the redox balance of the cell.

How does nuoK expression differ under various growth conditions in R. sphaeroides?

The expression level of nuoK and other respiratory complex components shows significant variation across different growth modes. Transcriptome analyses have revealed that one-fifth to one-third of R. sphaeroides genes show differential expression between growth conditions such as aerobic respiration, anaerobic respiration, and photosynthesis . Under autotrophic conditions, where CO₂ is the sole carbon source, the expression patterns of respiratory chain components including NADH dehydrogenase subunits are altered compared to heterotrophic growth . This adaptation helps the organism maintain appropriate electron flow and redox balance while minimizing oxidative stress. Specifically, when transitioning from heterotrophic to autotrophic growth, genes involved in ROS management show increased expression, suggesting that nuoK and other Complex I components must function in a highly regulated manner to prevent excessive ROS formation during CO₂ fixation .

What are the optimal conditions for heterologous expression of R. sphaeroides nuoK?

The expression of membrane proteins like nuoK presents significant challenges due to their hydrophobic nature. Based on successful approaches with other membrane proteins from R. sphaeroides, the following protocol is recommended:

  • Expression System Selection:

    • For bacterial expression: Modified E. coli C41(DE3) or C43(DE3) strains with reduced toxicity response

    • For native expression: R. sphaeroides itself under the control of the photosynthetic promoter pufQ

  • Expression Conditions for R. sphaeroides:

    • Temperature: 30°C

    • Light intensity: 10-15 W/m²

    • Medium: Modified Sistrom's minimal medium

    • Oxygen level: Microaerobic to anaerobic conditions to induce membrane development

  • Induction Protocol:

    • For heterologous systems: Slow induction with low IPTG concentrations (0.1-0.5 mM)

    • For native expression: Light-induced expression under anaerobic conditions

  • Co-expression Strategies:

    • Co-express with chaperones to improve folding

    • Consider expressing with adjacent subunits to improve stability

The advantage of using R. sphaeroides as an expression host lies in its extensive membrane surface area compared to conventional expression hosts, which provides more space for membrane protein integration .

What are the most effective methods for purifying recombinant nuoK while maintaining its structural integrity?

Purification of integral membrane proteins like nuoK requires specialized protocols:

  • Membrane Isolation:

    • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

    • Resuspend in buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl)

    • Disrupt cells by French press or sonication

    • Remove cell debris by centrifugation (10,000 × g, 20 min, 4°C)

    • Collect membranes by ultracentrifugation (150,000 × g, 1 h, 4°C)

  • Solubilization:

    • Resuspend membranes in solubilization buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl)

    • Add detergent gradually (recommended options):

      • n-Dodecyl β-D-maltoside (DDM): 1% (w/v)

      • Lauryl maltose neopentyl glycol (LMNG): 0.5% (w/v)

      • Digitonin: 1% (w/v)

    • Stir gently for 1-2 hours at 4°C

    • Remove insoluble material by ultracentrifugation (150,000 × g, 30 min, 4°C)

  • Affinity Purification:

    • For His-tagged constructs, use Ni-NTA or TALON resin

    • For other tags, use appropriate affinity matrices

    • Include detergent at concentrations above CMC in all buffers

    • Elute with imidazole gradient (20-300 mM) or other appropriate eluents

  • Size Exclusion Chromatography:

    • Further purify using Superdex 200 or similar

    • Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, detergent at 2-3× CMC

  • Stability Enhancement:

    • Consider amphipols or nanodiscs for long-term stability

    • Add lipids from R. sphaeroides to maintain native-like environment

This approach, similar to methods used for purifying GPCRs from R. sphaeroides, has been shown to preserve protein functionality .

What genome editing approaches are most efficient for modifying the nuoK gene in R. sphaeroides?

The most efficient genome editing approach for R. sphaeroides is the CRISPR-Cas9 system, which has been successfully adapted for this organism:

  • CRISPR-Cas9 System:

    • Utilize SpCas9 from Streptococcus pyogenes for targeted DNA cleavage

    • Design guide RNAs (gRNAs) specific to nuoK using tools optimized for R. sphaeroides' GC-rich genome

    • Deliver both Cas9 and gRNA using a plasmid with a compatible origin of replication for R. sphaeroides

    • Include homology repair templates for precise modifications

  • Homologous Recombination Template Design:

    • Create templates with 800-1000 bp homology arms flanking the desired modification

    • Optimize codon usage for R. sphaeroides (high GC content)

    • Include selection markers (e.g., antibiotic resistance) flanked by FRT sites for later removal

  • Implementation Protocol:

    • Transform R. sphaeroides with the CRISPR-Cas9 and template plasmid

    • Select transformants on appropriate antibiotics

    • Verify editing by PCR and sequencing

    • Remove selectable markers using FLP recombinase if necessary

This approach has achieved editing efficiencies of up to 100% for gene knockouts in R. sphaeroides, though knock-in efficiencies may be lower (approximately 15%) .

How can I develop an inducible expression system for controlled production of nuoK in R. sphaeroides?

A well-regulated inducible expression system for nuoK can be developed using the following approach:

  • Promoter Selection:

    • The photosynthetic promoter pufQ offers strong and highly regulated expression

    • This promoter is induced under low oxygen and light conditions

    • Alternative option: The superoperonic photosynthetic promoter system, which provides moderate but well-regulated expression levels

  • Vector Construction:

    • Start with a broad-host-range plasmid compatible with R. sphaeroides

    • Insert the selected promoter upstream of the nuoK gene

    • Include appropriate ribosome binding site and translation initiation signals

    • Add a C-terminal purification tag that doesn't interfere with membrane insertion

  • Expression Control Elements:

    • Incorporate oxygen-responsive regulatory elements to fine-tune expression

    • Consider adding a theophylline-responsive riboswitch for chemical induction in addition to environmental control

  • Optimization Strategy:

    • Test different growth conditions to find optimal expression levels

    • Adjust light intensity (5-30 W/m²) and oxygen levels to modulate expression

    • Monitor protein production using Western blot or fluorescent tags

This approach takes advantage of R. sphaeroides' natural regulatory mechanisms while providing experimental control over expression levels .

What spectroscopic methods can be used to study the electron transfer activities of recombinant nuoK?

Several spectroscopic techniques can provide insights into the electron transfer functions of recombinant nuoK:

  • UV-Visible Spectroscopy:

    • Monitor NADH oxidation at 340 nm

    • Follow quinone reduction at appropriate wavelengths

    • Measure spectra between 300-700 nm to detect changes in cofactor redox states

  • EPR Spectroscopy:

    • X-band EPR (9 GHz) to detect iron-sulfur clusters and semiquinone radicals

    • Temperature range: 5-100K for different paramagnetic species

    • Sample preparation: concentrated protein (100-200 μM) in quartz tubes

  • FTIR Difference Spectroscopy:

    • Detect proton-pumping activity through monitoring protonation changes

    • Calculate difference spectra between active and inactive states

    • Resolution: 4 cm⁻¹, accumulating 1000-2000 scans

  • Resonance Raman Spectroscopy:

    • Excitation wavelengths: 413 nm (for heme cofactors) and 441 nm (for flavins)

    • Detect structural changes in cofactors during electron transfer

    • Sample concentration: 50-100 μM in appropriate buffer

  • Stopped-Flow Spectroscopy:

    • Measure reaction rates of electron transfer

    • NADH-to-quinone electron transfer can be measured at millisecond timescales

    • Temperature-controlled experiments (10-40°C) to calculate activation energies

How does the structure-function relationship of nuoK compare between photosynthetic and non-photosynthetic growth conditions?

The structure-function relationship of nuoK shows significant adaptation between photosynthetic and non-photosynthetic growth conditions:

  • Structural Adaptations:

    • Under photosynthetic conditions, nuoK likely undergoes conformational changes to optimize interaction with other respiratory/photosynthetic components

    • Membrane composition changes between growth conditions, affecting nuoK stability and activity

    • Protein-protein interaction networks differ, with nuoK potentially forming different supercomplexes

  • Functional Differences:

    • Under photosynthetic conditions, the proton gradient is primarily maintained by photosynthetic complexes, reducing the proton-pumping demand on Complex I

    • During aerobic respiration, nuoK contributes more significantly to the proton motive force

    • The role in ROS management becomes critical under autotrophic conditions

  • Experimental Approach to Compare:

    • Grow R. sphaeroides under three conditions: aerobic respiration, anaerobic respiration, and photosynthesis

    • Isolate membrane fractions from each condition

    • Perform Blue Native PAGE to identify complex formation differences

    • Measure proton-pumping activity using pH-sensitive dyes or electrodes

    • Analyze ROS production using H₂O₂-specific probes

  • Observed Differences (Based on Similar Studies):

    Growth ConditionComplex I ActivityROS ProductionSupercomplex Formation
    AerobicHighModerateMinimal
    Anaerobic DarkModerateLowModerate
    PhotosyntheticLow-ModerateVariableExtensive

These adaptations reflect the metabolic flexibility of R. sphaeroides and its ability to optimize electron transport for different energy generation modes .

How can synthetic biology approaches be used to engineer nuoK for enhanced electron transfer efficiency?

Synthetic biology offers several approaches to enhance nuoK's electron transfer efficiency:

  • Rational Design Strategies:

    • Identify key residues in proton channels using homology modeling

    • Introduce point mutations to optimize proton transfer pathways

    • Modify quinone binding sites for improved substrate interaction

    • Engineer disulfide bridges to stabilize optimal conformations

  • Directed Evolution Approach:

    • Create a nuoK variant library using error-prone PCR

    • Develop a selection system based on growth under energy-limited conditions

    • Use FACS with ROS-sensitive dyes to select variants with optimal electron transfer

    • Iterate selection over multiple generations

  • Chimeric Protein Construction:

    • Create fusion proteins with components from extremophile organisms

    • Swap transmembrane segments with homologs from organisms with higher efficiency

    • Test hybrid proteins with domains from both respiratory and photosynthetic complexes

  • Implementation Methods:

    • Use the CRISPR-Cas9 system for precise genomic integration of optimized variants

    • Develop synthetic operons for coordinated expression of modified nuoK with partner subunits

    • Employ inducible promoters for temporal control of expression

  • Validation Techniques:

    • Measure electron transfer rates using spectroscopic methods

    • Calculate ATP production efficiency using luciferase-based assays

    • Monitor growth rates under different conditions

    • Quantify ROS production to assess electron leakage

These approaches can be particularly valuable for enhancing R. sphaeroides' ability to convert CO₂ into high-value materials by optimizing energy conservation .

What are the challenges and solutions for studying protein-protein interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex?

Studying protein-protein interactions involving nuoK presents several challenges with corresponding solutions:

Challenges:

  • Membrane Environment Disruption:

    • Detergent solubilization can disturb native interactions

    • Hydrophobic subunits may aggregate when removed from membrane

  • Complex Instability:

    • The multi-subunit nature of Complex I makes isolation difficult

    • Individual subunits may not fold properly in isolation

  • Transient Interactions:

    • Dynamic interactions during the catalytic cycle are difficult to capture

    • Conformational changes may be lost in static analyses

Solutions and Methodologies:

  • In vivo Approaches:

    • FRET Analysis: Tag nuoK and potential interaction partners with fluorescent proteins

    • Split GFP Complementation: Divide GFP between nuoK and partner proteins

    • In vivo Crosslinking: Use photo-activatable crosslinkers to capture interactions

  • Membrane-Mimetic Systems:

    • Nanodiscs: Reconstitute nuoK with partners in defined lipid discs

    • Native Nanodiscs: Extract membrane patches with intact complexes

    • Liposome Reconstitution: Reconstruct functional complexes in liposomes

  • Advanced Biophysical Techniques:

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Map interaction surfaces

    • Single-Particle Cryo-EM: Visualize intact complexes in different states

    • Solid-State NMR: Analyze interactions in membrane-embedded states

  • Genetic Approaches:

    • Suppressor Mutation Analysis: Identify compensatory mutations that restore function

    • Disulfide Crosslinking: Engineer cysteines to form crosslinks at interaction sites

    • BN-PAGE Analysis: Compare complex assembly with modified subunits

These methodologies, when combined, can provide a comprehensive understanding of how nuoK interacts with other Complex I subunits in the context of R. sphaeroides' diverse metabolic capabilities .

What is the role of nuoK in the context of R. sphaeroides' metabolic versatility across different growth conditions?

The nuoK subunit plays a pivotal role in supporting R. sphaeroides' remarkable metabolic versatility:

  • Adaptive Electron Transport Chain Configuration:

    • During aerobic respiration: nuoK participates in canonical respiratory Complex I function

    • Under anaerobic respiration: Alternative electron acceptors require reconfiguration of electron flow

    • During photosynthesis: Coordination with photosystem components becomes crucial

  • Carbon Metabolism Integration:

    • Under heterotrophic conditions: nuoK helps oxidize NADH generated from sugar metabolism

    • Under autotrophic conditions: Complex I activity must balance with the Calvin-Benson-Bassham cycle, which requires precise regulation of electron flow

    • The transition between growth modes involves massive changes in gene expression (20-33% of all genes)

  • Bioenergetic Flexibility:

    • Complex I containing nuoK contributes differently to the proton motive force depending on growth conditions

    • When shifting from heterotrophic to autotrophic growth, the efficiency of energy conservation becomes critical

    • R. sphaeroides contains multiple electron transport chain components, including duplicate NADH dehydrogenases, which may have specialized roles under different conditions

  • Experimental Evidence of Adaptation:

    • Transcriptome analysis shows differential expression of respiratory components across growth modes

    • Modified strains with enhanced ROS management show improved growth under autotrophic conditions

    • The metabolic network reconfiguration involves coordinated changes in multiple pathways

  • Proposed Regulatory Mechanism:

    • Oxygen levels directly affect nuoK expression through regulatory proteins

    • Redox state sensing systems modulate Complex I activity

    • Light-responsive elements coordinate respiratory and photosynthetic functions

    • Metabolic feedback loops fine-tune electron transport to match carbon assimilation needs

This integrated perspective explains how nuoK contributes to R. sphaeroides' ability to thrive across diverse environmental conditions, from aerobic heterotrophy to anaerobic photoautotrophy .

How can nuoK be engineered for biotechnological applications in bioremediation and bioenergy production?

Engineering nuoK offers several promising biotechnological applications:

  • Enhanced Electron Transfer for Bioremediation:

    • Azo Dye Degradation: Engineer nuoK to improve electron delivery to azoreductases

      • Recent findings suggest convergent evolution between NADH quinone oxidoreductases and azoreductases

      • Modified nuoK could enhance electron flow to these detoxifying enzymes

    • Heavy Metal Reduction: Optimize nuoK for efficient electron transfer to metal-reducing pathways

    • Implementation Strategy: Create chimeric proteins combining nuoK with azoreductase domains

  • Bioenergy Production Optimization:

    • Hydrogen Production: Engineer nuoK to redirect electron flow toward hydrogenases

      • Modify quinone binding sites to alter electron partition between pathways

      • Create regulatory switches to control electron flow distribution

    • Bioelectricity Generation: Enhance extracellular electron transfer for microbial fuel cells

      • Couple nuoK to synthetic electron conduits to cell surface

      • Optimize proton pumping to maintain appropriate membrane potential

  • CO₂ Fixation Enhancement:

    • Improve Autotrophic Growth: Engineer nuoK for optimal function under CO₂ fixation conditions

      • Target ROS reduction while maintaining efficient energy conservation

      • Enhanced strains could show up to 110% faster growth rates under autotrophic conditions

    • Metabolic Engineering Approach: Coordinate nuoK modifications with Calvin cycle enhancements

  • Experimental Design for Validation:

    • Construct library of nuoK variants using site-directed mutagenesis

    • Screen variants using high-throughput assays for:

      • Electron transfer rates to different acceptors

      • ROS production

      • Growth rates under different conditions

    • Validate promising candidates in bioremediation test systems

This engineering approach leverages R. sphaeroides' natural capabilities while enhancing specific functions through targeted modifications of the electron transport chain .

What are the current knowledge gaps in understanding the structure and function of nuoK, and which experimental approaches could address them?

Several significant knowledge gaps exist in our understanding of nuoK, with corresponding experimental approaches to address them:

Knowledge Gap 1: High-Resolution Structure

  • Current Limitation: Lack of atomic-resolution structure of R. sphaeroides nuoK

  • Experimental Approaches:

    • Cryo-EM of intact Complex I from R. sphaeroides

    • X-ray crystallography of engineered constructs with stabilizing mutations

    • Integrative structural biology combining crosslinking-mass spectrometry with computational modeling

    • NMR studies of isolated transmembrane segments in membrane mimetics

Knowledge Gap 2: Proton Translocation Mechanism

  • Current Limitation: Unclear how exactly nuoK contributes to proton pumping

  • Experimental Approaches:

    • Site-directed mutagenesis of putative proton pathway residues

    • Time-resolved FTIR to track protonation changes during catalysis

    • Computational simulations of proton movement through channels

    • Development of fluorescent probes to track localized pH changes

Knowledge Gap 3: Regulatory Mechanisms

  • Current Limitation: Poor understanding of how nuoK activity is regulated under different conditions

  • Experimental Approaches:

    • Phosphoproteomics to identify post-translational modifications

    • Quantitative proteomics to track Complex I composition changes

    • Ribosome profiling to analyze translation regulation

    • Development of real-time activity sensors for live-cell imaging

Knowledge Gap 4: Subunit-Specific Functions

  • Current Limitation: Difficulty distinguishing nuoK functions from other Complex I subunits

  • Experimental Approaches:

    • CRISPR interference for transient, tunable repression of nuoK

    • Single-molecule studies of reconstituted subcomplexes

    • Complementation assays with heterologous nuoK variants

    • Engineering minimal functional units to define essential interactions

Knowledge Gap 5: Integration with Metabolic Networks

  • Current Limitation: Incomplete understanding of how nuoK activity influences and responds to metabolic states

  • Experimental Approaches:

    • Metabolic flux analysis using stable isotope labeling

    • Multi-omics approaches correlating nuoK activity with metabolite profiles

    • Development of biosensors reporting on NADH/NAD⁺ ratios

    • Systems biology modeling to predict nuoK's role in metabolic adaptations

Addressing these knowledge gaps would significantly advance our understanding of how R. sphaeroides optimizes its electron transport chain for diverse growth conditions and could inform biotechnological applications ranging from bioremediation to sustainable bioproduction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.