Recombinant Rhodobacter sphaeroides Nitric oxide reductase subunit C (norC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag is required, please inform us, and we will prioritize its development.
Synonyms
norC; Rsph17025_0970; Nitric oxide reductase subunit C; NOR small subunit; Nitric oxide reductase cytochrome c subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-147
Protein Length
Full Length of Mature Protein
Species
Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Target Names
norC
Target Protein Sequence
SEILTKSRARNVFYGGSLFFIAVFVGLTVQSHNYVVSTTPALTDEVILGKHVWERNSCIN CHTLHGEGAYFAPEVGNVMTRWGVLDDPDAAAEMLGGWMDAQPSGVEGRRQMPHFELTDE EKRGLSEFLRWADQMNTQSWPPNDAG
Uniprot No.

Target Background

Function
A component of the anaerobic respiratory chain, responsible for the conversion of nitrate to dinitrogen (denitrification).
Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the genetic organization of the nitric oxide reductase region in Rhodobacter sphaeroides?

The nitric oxide reductase gene cluster in R. sphaeroides 2.4.3 contains six genes that constitute an operon. Sequence analysis indicates that the two proximal genes in the cluster (norC and norB) are the Nor structural genes, followed by norQ, norD, nnrT, and nnrU . The norCBQD gene products show significant identity with proteins from other denitrifiers, while the predicted nnrT and nnrU gene products have no similarity with products corresponding to other sequences in the database .

The G+C content for the 5,984 bp region is approximately 68%, which is similar to the chromosomal average for R. sphaeroides . A notable feature of this gene organization is that the putative termination codons and translation start sites of norB and norQ, as well as nnrT and nnrU, overlap, suggesting translational coupling .

What is the function of norC in Rhodobacter sphaeroides?

NorC is one of the structural components of the nitric oxide reductase (Nor) complex in R. sphaeroides 2.4.3. This complex catalyzes the reduction of nitric oxide (NO) to nitrous oxide (N₂O) during denitrification, which is the process where nitrate (NO₃⁻) is reduced to gaseous products, primarily nitrogen gas .

Mutational analysis has confirmed that norC is specifically required for the expression of an active Nor complex . Without functional norC, bacteria cannot perform the NO reduction step of denitrification, leading to NO accumulation which is toxic to cells . This function is critical because:

  • It contributes to energy generation during denitrification

  • It prevents NO toxicity in the cell

  • It completes a key step in the nitrogen cycle

How is the expression of norC regulated in Rhodobacter sphaeroides?

The expression of norC and other genes in the nor operon is tightly regulated by environmental conditions. Regulatory studies have demonstrated that the first four genes (norCBQD) are expressed only when:

  • The oxygen concentration is low (microaerobic conditions)

  • Nitrate is present in the growth medium

This regulation appears to be controlled by specific sequences in the regulatory region upstream of norC. Centered at position -69.5 relative to the start of translation of norC is a sequence (5'-TTGTG(N4)CGCAA-3') that has similarity to the consensus binding site sequence of the transcriptional activator Fnr, which regulates gene expression in response to oxygen availability .

Deletion analysis of the regulatory region upstream of norC indicated that a sequence motif with identity to a motif in the gene encoding nitrite reductase in strain 2.4.3 is critical for nor operon expression . This ensures that the Nor complex is produced only when needed for denitrification.

What methodological approaches are used to study norC function?

Several complementary methodological approaches are employed to study norC function:

  • Genetic manipulation:

    • Creation of norC deletion mutants

    • Site-directed mutagenesis of key residues

    • Construction of reporter gene fusions (e.g., lacZ) to study expression

  • Expression analysis:

    • Transcriptional studies under varying oxygen and nitrate conditions

    • Protein expression detection via Western blotting

    • Reporter gene assays to quantify promoter activity

  • Functional assays:

    • Measurement of NO reduction activity

    • Growth phenotype analysis under denitrifying conditions

    • Measurement of denitrification pathway intermediates

  • Recombinant expression:

    • Cloning and expression in heterologous hosts

    • Purification of recombinant NorC protein

    • In vitro reconstitution of Nor activity

These approaches allow researchers to comprehensively characterize the expression, regulation, and function of norC in R. sphaeroides .

What is the relationship between norC and other genes in the nor operon?

The nor operon in R. sphaeroides 2.4.3 consists of six genes with distinct but related functions:

  • norC and norB: Encode the structural components of the nitric oxide reductase (Nor) complex

  • norQ and norD: Required for the expression of an active Nor complex, likely involved in cofactor assembly or complex maturation

  • nnrT and nnrU: Required for expression of both nitrite reductase (Nir) and Nor, suggesting a broader regulatory role

While the first four genes (norCBQD) are only expressed under microaerobic conditions in the presence of nitrate, the two distal genes (nnrTU) are expressed constitutively . This differential regulation suggests that nnrT and nnrU may play additional roles beyond denitrification.

Mutational and functional complementation studies indicate that nnrT and nnrU can be expressed from an internal promoter, which explains their ability to be expressed independently of the regulatory mechanisms controlling norCBQD .

What factors affect the successful expression of recombinant norC in heterologous systems?

Expression of recombinant norC in heterologous systems presents multiple challenges. Based on understanding of the native regulation and protein properties, the following factors significantly impact successful expression:

  • Host selection:

    • E. coli strains specialized for membrane protein expression (e.g., C41/C43)

    • Purple non-sulfur bacterial hosts that naturally express similar proteins

    • Expression hosts with appropriate heme biosynthesis pathways

  • Vector design considerations:

    • Promoter selection (balancing strength with control)

    • Inclusion of appropriate fusion tags for detection and purification

    • Codon optimization for the selected host

    • Co-expression with norB and potentially other nor genes

  • Growth and induction conditions:

    • Temperature (typically lower than standard to improve folding)

    • Oxygen limitation to mimic native expression conditions

    • Addition of nitrate or nitrate analogs as inducers

    • Supplementation with heme precursors

  • Protein extraction and purification:

    • Gentle membrane protein extraction methods

    • Selection of appropriate detergents for solubilization

    • Purification strategies that maintain the native structure

    • Methods to verify proper cofactor incorporation

Systematic optimization of these parameters is necessary to obtain functional recombinant norC suitable for biochemical and structural studies.

How does the interaction between NorC and NorB contribute to nitric oxide reduction?

The interaction between NorC and NorB is fundamental to the function of the nitric oxide reductase complex. While the detailed mechanism of their interaction is not fully elucidated in the search results, analysis of the gene organization and mutational studies provide significant insights:

  • Structural arrangement:

    • NorC and NorB form a membrane-bound complex

    • The genes are adjacent and likely translationally coupled, suggesting a close physical interaction

    • Both proteins are required for Nor activity, as demonstrated by mutational analysis

  • Functional roles:

    • NorC likely contains c-type heme(s) that accept electrons from donor proteins

    • NorB likely contains the catalytic site where NO reduction occurs

    • The electron transfer pathway presumably proceeds from NorC to NorB to the substrate

  • Regulatory interaction:

    • Both proteins must be correctly expressed and assembled for function

    • Mutations in either gene result in loss of Nor activity

    • The presence of downstream genes (norQ and norD) suggests additional factors required for proper assembly or function

Further studies employing techniques such as protein-protein interaction analysis, electron transfer kinetics, and structural biology would provide more detailed insights into this critical interaction.

What is the role of the Fnr-like binding site in the regulation of norC expression?

The nor operon regulatory region contains an Fnr-like binding site (5'-TTGTG(N4)CGCAA-3') centered at position -69.5 relative to the translation start of norC . This sequence motif appears to play a critical role in oxygen-dependent regulation of the nor operon:

  • Oxygen sensing:

    • The Fnr-like binding site likely enables response to low oxygen conditions

    • Fnr is a well-characterized transcriptional regulator that becomes active under anaerobic conditions

    • This mechanism ensures that the energy-intensive Nor complex is only produced when oxygen is limited

  • Integration with nitrate regulation:

    • The regulatory studies demonstrate that norCBQD expression requires both low oxygen and nitrate presence

    • The Fnr-like binding site may work in concert with nitrate-responsive regulatory elements

    • This dual regulation ensures that Nor is only expressed when conditions favor denitrification

  • Coordinate regulation:

    • Sequence motifs with identity to those in the nitrite reductase gene regulatory region suggest coordinate regulation of multiple denitrification genes

    • This allows the bacterium to express the complete denitrification pathway in a synchronized manner

Deletion analysis of the regulatory region upstream of norC confirmed that this sequence motif is critical for nor operon expression , supporting its role as a key regulatory element controlling norC transcription in response to environmental conditions.

How can researchers distinguish between effects on NorC expression versus effects on NorC activity?

Distinguishing between effects on NorC expression and activity is crucial for interpreting experimental results correctly. A methodological approach to make this distinction includes:

  • Expression level assessment:

    • Quantitative PCR to measure norC mRNA levels

    • Western blotting with anti-NorC antibodies for protein detection

    • Reporter gene fusions (e.g., norC-lacZ) to monitor transcription/translation

    • Mass spectrometry for protein quantification

  • Activity measurements:

    • Direct enzyme activity assays measuring NO consumption

    • Spectroscopic monitoring of electron transfer

    • Product formation (N₂O) quantification

    • In vivo growth phenotypes under denitrifying conditions

  • Comparative analysis:

    • Calculate specific activity (activity per unit protein)

    • Perform time-course studies separating expression and activity phases

    • Compare wild-type and mutant proteins side-by-side

    • Conduct in vitro reconstitution with purified components

  • Control experiments:

    • Express catalytically inactive mutants to separate expression from activity

    • Use inhibitors to block activity without affecting expression

    • Employ uncoupled expression systems to bypass native regulation

Results from such analyses might be presented in a comparative table:

Experimental ConditionnorC mRNA Level (relative)NorC Protein ExpressionNO Reductase ActivityInterpretation
Aerobic growthLowUndetectableNoneExpression inhibited
Microaerobic without nitrateLowUndetectableNoneExpression inhibited
Microaerobic with nitrateHighHighHighNormal expression and activity
Microaerobic with nitrate + inhibitorHighHighLowActivity affected, not expression
norC point mutationHighHighLowProtein expressed but not active
norQ mutationHighLowNonePost-translational effect

This systematic approach allows researchers to determine whether observed phenotypes result from changes in norC expression or alterations in the activity of the expressed protein.

What analytical techniques are most effective for characterizing recombinant NorC?

Comprehensive characterization of recombinant NorC requires multiple complementary analytical techniques:

  • Protein purity and identity:

    • SDS-PAGE with Coomassie or silver staining

    • Western blotting with antibodies against NorC or affinity tags

    • Mass spectrometry for protein identification and integrity verification

    • N-terminal sequencing to confirm proper processing

  • Structural analysis:

    • UV-visible spectroscopy to assess heme incorporation

    • Circular dichroism (CD) spectroscopy for secondary structure

    • Fluorescence spectroscopy for tertiary structure

    • Size exclusion chromatography to evaluate oligomeric state

  • Functional assessment:

    • Spectrophotometric NO reduction assays

    • Oxygen electrode measurements (NO competes with O₂)

    • Electron transfer kinetics

    • N₂O production quantification by gas chromatography

  • Interaction studies:

    • Co-purification with NorB and other complex components

    • Blue native PAGE to detect intact complexes

    • Surface plasmon resonance for interaction kinetics

    • Crosslinking followed by mass spectrometry for interface mapping

Each technique provides specific information about different aspects of the recombinant protein, and their combined application enables comprehensive characterization.

How can site-directed mutagenesis be used to investigate the functional domains of NorC?

Site-directed mutagenesis is a powerful approach for identifying functional domains and key residues in NorC. A methodological approach includes:

  • Target selection:

    • Conserved residues identified through sequence alignment with homologs

    • Predicted heme-binding sites (typically histidine residues)

    • Predicted membrane-spanning or surface-exposed regions

    • Putative interaction interfaces with NorB

  • Mutagenesis strategy:

    • Conservative mutations (e.g., His→Asn) to test specific functions

    • Alanine-scanning mutagenesis for systematic analysis

    • Domain swapping with homologous proteins

    • Insertion of specific tags or reporter groups at different positions

  • Functional assessment:

    • Expression and stability analysis of mutant proteins

    • Spectroscopic assessment of heme incorporation

    • Complex formation with NorB

    • NO reduction activity measurements

  • Data analysis and interpretation:

    • Correlation of mutations with activity changes

    • Structure-function relationship mapping

    • Identification of critical residues and domains

    • Model development based on experimental findings

Results from such mutagenesis studies might be presented in a table format:

MutationExpression Level (% of WT)Heme IncorporationComplex FormationNO Reduction Activity (% of WT)Interpretation
Wild-type100CompleteNormal100Reference
H25A95PartialNormal15Heme coordination
D40N90CompleteReduced40NorB interface
R75K100CompleteNormal95Non-critical residue
W120A30CompleteDisrupted10Structural role

This systematic approach allows for comprehensive mapping of functional domains within NorC.

What are the optimal conditions for expressing recombinant norC in heterologous systems?

Based on the regulatory information provided in the search results, optimal expression of recombinant norC should consider multiple factors:

  • Expression system design:

    • Select hosts appropriate for membrane protein expression

    • Design vectors with tunable promoters

    • Consider fusion tags that enhance folding and solubility

    • Include sequences for proper membrane targeting

  • Growth conditions:

    • Temperature: Often lower temperatures (16-20°C) improve folding

    • Oxygen: Microaerobic conditions mimic native expression environment

    • Media: Rich media supplemented with heme precursors

    • Inducers: Consider nitrate addition to mimic native regulation

  • Induction strategy:

    • Timing: Typically at mid-log phase

    • Duration: Extended expression periods at lower temperatures

    • Inducer concentration: Optimized to balance expression and toxicity

    • Co-expression: Consider simultaneous expression of norB and other helper proteins

  • Post-induction handling:

    • Gentle cell disruption methods

    • Appropriate detergents for membrane protein extraction

    • Buffer optimization for stability

    • Cofactor supplementation if needed

A systematic optimization approach testing these variables through factorial design would identify the optimal conditions for norC expression in a particular heterologous system.

How can researchers validate that recombinant NorC is functionally equivalent to native NorC?

Functional equivalence validation is essential for ensuring that experimental results with recombinant proteins accurately reflect native protein properties. A comprehensive approach includes:

  • Biochemical characterization:

    • Compare kinetic parameters (Km, Vmax, kcat)

    • Assess substrate specificity and product formation

    • Determine pH and temperature optima

    • Measure inhibitor sensitivity profiles

  • Structural analysis:

    • Spectroscopic comparison of heme environments

    • Secondary and tertiary structure analysis

    • Mass spectrometry for post-translational modifications

    • Thermal stability assessments

  • Functional complementation:

    • Test ability of recombinant NorC to restore function in norC-deficient strains

    • Measure growth characteristics under denitrifying conditions

    • Assess in vivo NO reduction capacity

    • Analyze protein-protein interaction profiles

  • Comparative data analysis:

    • Side-by-side testing under identical conditions

    • Statistical analysis of multiple preparations

    • Evaluation of batch-to-batch consistency

    • Assessment of long-term stability

A comprehensive comparison table might look like:

ParameterNative NorCRecombinant NorCStatistical Significance
Molecular mass (kDa)17.2 ± 0.117.3 ± 0.1p > 0.05 (NS)
Heme content (mol/mol)1.0 ± 0.050.95 ± 0.07p > 0.05 (NS)
Km for NO (μM)2.5 ± 0.32.8 ± 0.4p > 0.05 (NS)
Vmax (μmol/min/mg)320 ± 25290 ± 30p > 0.05 (NS)
pH optimum7.27.3N/A
Thermal stability (T50, °C)42.5 ± 1.041.0 ± 1.2p > 0.05 (NS)
NorB binding (Kd, nM)35 ± 540 ± 7p > 0.05 (NS)
Complementation (% activity)10092 ± 5p > 0.05 (NS)

How can transcriptional regulation of the nor operon be quantitatively assessed?

Based on the regulatory information in the search results, several approaches can be used to quantitatively assess nor operon transcriptional regulation:

  • Reporter gene fusions:

    • Construction of norC promoter-lacZ fusions

    • Measurement of β-galactosidase activity under different conditions

    • Deletion and mutation analysis of promoter elements

    • Quantification of the effects of regulatory mutations

  • Real-time quantitative PCR:

    • Design of primers specific for each nor operon gene

    • RNA isolation from cells grown under various conditions

    • Quantification of transcript levels relative to reference genes

    • Temporal analysis of expression patterns

  • RNA-seq analysis:

    • Global transcriptome analysis under various conditions

    • Identification of co-regulated genes

    • Mapping of transcription start sites

    • Analysis of regulatory networks

  • Protein expression analysis:

    • Western blotting with specific antibodies

    • Quantitative proteomics

    • Time-course studies of protein accumulation

    • Correlation with transcript levels

The search results indicate that expression of norCBQD is regulated by oxygen and nitrate, while nnrTU are expressed constitutively . These differential expression patterns can be quantitatively measured and compared using the techniques above to build a comprehensive model of nor operon regulation.

What strategies can address protein misfolding or lack of cofactor incorporation in recombinant NorC?

Proper folding and cofactor incorporation are critical challenges when working with recombinant NorC. Effective strategies include:

  • Cofactor availability enhancement:

    • Supplement growth media with heme or heme precursors (δ-aminolevulinic acid)

    • Co-express heme biosynthesis enzymes

    • Use hosts with efficient heme production pathways

    • Consider in vitro heme reconstitution after purification

  • Folding optimization:

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Add chemical chaperones to growth media (glycerol, trehalose)

    • Express at reduced temperatures (16-20°C) to slow folding

    • Use specialized membrane protein expression hosts

  • Extraction and purification refinement:

    • Select gentle detergents appropriate for membrane proteins

    • Include stabilizing ligands during purification

    • Optimize buffer composition (pH, ionic strength, additives)

    • Consider nanodiscs or other membrane mimetics for stabilization

  • Quality control implementation:

    • Develop spectroscopic assays to confirm heme incorporation

    • Implement activity assays at multiple purification stages

    • Use size exclusion chromatography to assess aggregation

    • Apply thermal shift assays to evaluate protein stability

A systematic troubleshooting approach addressing these factors can significantly improve the quality of recombinant NorC preparations.

What considerations are important when designing primers for amplifying and cloning norC?

Primer design is a crucial first step in molecular cloning of norC. Key considerations include:

  • Sequence specificity:

    • Design based on confirmed norC sequence from R. sphaeroides 2.4.3

    • Check for strain-specific sequence variations

    • Ensure specificity to avoid amplification of related genes

    • Verify against the complete genome sequence

  • Technical parameters:

    • Optimal length (typically 18-30 nucleotides)

    • Balanced GC content (40-60%)

    • Similar melting temperatures for primer pairs (within 5°C)

    • Avoidance of secondary structures and primer-dimer formation

  • Cloning features:

    • Inclusion of appropriate restriction sites absent from norC sequence

    • Addition of 5-6 base overhangs for efficient enzyme digestion

    • Consideration of reading frame for expression constructs

    • Potential inclusion of sequences for affinity tags

  • Special considerations for norC:

    • Attention to signal sequences and membrane-spanning regions

    • Options for full-length versus truncated versions

    • Compatibility with downstream applications

    • Consideration of codon optimization for the expression host

A table of sample primers might include:

Primer PurposeSequence (5' to 3')Features
Full norC forwardGGATCCATGACCGAAGCCTACCTGAAGBamHI site, start codon
Full norC reverseAAGCTTCTAGACCGTGCCCTTGACGATCHindIII site, stop codon
Mature norC forwardCCATGGGTACCGAAGCCTACCTGAAGAACGNcoI site, no signal sequence
Tag fusion reverseCTCGAGGTGCCCTTGACGATCAGGAAGXhoI site, no stop codon
Sequencing primerGCAGATCGAGTACCTGAACCInternal binding, no restriction sites

Careful primer design ensures successful amplification and subsequent cloning of norC.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.