Recombinant Rhodobacter sphaeroides Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

The kdpC subunit is part of a heterotrimeric Kdp ATPase complex (KdpABC), with:

  • KdpB: Catalytic subunit (70 kDa in R. sphaeroides)

  • KdpA: Transmembrane K⁺-binding subunit (43.5 kDa)

  • KdpC: Regulatory subunit (23.5 kDa)

Key Features:

  • ATP Hydrolysis: kdpC modulates ATPase activity, coupling energy (ATP) to K⁺ transport .

  • Vanadate Sensitivity: Distinguishes it from F₁F₀ ATPases (inhibited by vanadate) .

  • Substrate Specificity: Preferentially hydrolyzes ATP, with minimal activity toward GTP or CTP .

Functional Role in Rhodobacter sphaeroides

KdpC is essential for adapting to low K⁺ environments. Key findings include:

ParameterValueSource
ATPase Activity Stimulation (1 mM K⁺)3.1-fold increase
Subunit Mass (kdpC)23.5 kDa
Optimal pH for ATPase ActivitypH 7.2–7.8 (internal)

Mechanism:

  1. K⁺ Binding: KdpA binds extracellular K⁺, triggering conformational changes.

  2. ATP Hydrolysis: kdpC facilitates ATP cleavage, driving K⁺ translocation.

  3. Regulation: Activity is modulated by intracellular K⁺ levels and ATP availability .

Metabolic Engineering for Coenzyme Q10 (CoQ10) Production

Overexpression of kdpC in R. sphaeroides was tested to enhance CoQ10 biosynthesis, but results were inconclusive:

StrainCoQ10 Titer (mg/L)Change vs. Wild-TypeSource
RS.KdpC360.17 ± 0.39No significant increase
RS.KdpC–GAPDH (Tandem)359.87 ± 1.14No significant increase

Comparative Biochemical Analysis

The R. sphaeroides Kdp system shares structural and functional homology with E. coli Kdp ATPase:

FeatureR. sphaeroidesE. coli
Subunit Masses (kDa)70, 43.5, 23.573, 44, 24
Vanadate SensitivityHighHigh
Optimal pH7.2–7.8Similar

Future Directions

  1. Biotechnological Applications: Exploring kdpC in biofuel production (e.g., hydrogen) or bioremediation .

  2. Structural Studies: Resolving kdpC’s 3D structure to elucidate ATPase regulation mechanisms .

  3. Synergistic Engineering: Combining kdpC with glycolytic enzymes (e.g., GAPDH) for optimized metabolic flux .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; Rsph17029_2925; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Target Names
kdpC
Target Protein Sequence
MMTHLRPALASLLALSLLTGVAYPLALTGIAAVIAPDRAAGSLILREGQVVGSALIGQGF DGPGYLHPRPSASDWNAAGTSASNLGPTSAALLAEVQERQAAYEAQNGAPAPVDAVTASG SGLDPHVSPANARAQAARIARARGLDEAAVRRLIEAHVEPPLLGLWGQARVNVLAVNLAL DAAGA
Uniprot No.

Target Background

Function
The Recombinant Rhodobacter sphaeroides Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by forming a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the genomic context of the kdpC gene in Rhodobacter sphaeroides?

The kdpC gene in Rhodobacter sphaeroides encodes the C chain of the potassium-transporting ATPase, which functions as an adenosine triphosphate hydrolase. In R. sphaeroides KD131, the complete genome consists of two chromosomes and two plasmids, with chromosome 1 containing 3,152,792 bp (3,101 open reading frames, 39 tRNAs, and one 16S-23S-5S rRNA) and chromosome 2 containing 1,297,647 bp (1,224 ORFs, 15 tRNAs, and three 16S-23S-5S rRNAs). The genome has a G+C content of approximately 68.7% to 70.1% . The genomic organization of energy metabolism genes, including kdpC, is highly conserved among Rhodobacter species, though specific localization would require targeted genomic analysis.

How does kdpC function in the energy metabolism of Rhodobacter sphaeroides?

KdpC functions as an adenosine triphosphate hydrolase in R. sphaeroides, playing a crucial role in the energy metabolism pathways. This component is part of the potassium-transporting ATPase system that contributes to maintaining ion homeostasis while participating in cellular bioenergetics. Research investigating metabolic engineering of R. sphaeroides has included kdpC overexpression to potentially enhance production of valuable compounds like coenzyme Q10 (CoQ10) . Similar to other ATP-dependent systems in related species like R. capsulatus, these energy-coupling proteins are often essential for growth under specific conditions, particularly when cells need to maintain precise ion gradients across membranes .

How does recombinant expression affect the functionality of kdpC compared to native expression?

Recombinant expression of kdpC in R. sphaeroides presents several functional considerations compared to native expression. When overexpressed as part of metabolic engineering strategies, recombinant kdpC does not appear to significantly alter the production of compounds like CoQ10 when expressed alone . This suggests that single-gene overexpression may not overcome rate-limiting steps in complex metabolic pathways. For optimal functionality of recombinant kdpC, researchers should consider:

  • Promoter selection for appropriate expression levels

  • Codon optimization for the host organism

  • Post-translational modifications required for activity

  • Potential disruption of native protein-protein interactions

Comparative functional analysis between native and recombinant kdpC requires careful experimental design with appropriate controls to isolate the effects of expression level from those of protein modification or localization.

What is the relationship between kdpC expression and hydrogen production in R. sphaeroides?

R. sphaeroides KD131 is known for producing high levels of biohydrogen and has been genetically developed to produce H2 under various conditions, regardless of light presence . While the direct relationship between kdpC and hydrogen production is not explicitly detailed in the search results, the connection likely involves energy metabolism coordination.

The hydrogen-evolving system in R. sphaeroides KD131 consists primarily of uptake hydrogenase and two nitrogenases. This strain appears to contain a more developed H2-evolving system than related strains, including both a molybdenum nitrogenase gene cluster and an additional iron nitrogenase gene cluster that shows similarity to homologues in Rhodopseudomonas palustris CGA009 . As kdpC participates in energy metabolism through ATP hydrolysis, its activity may influence the energy balance available for hydrogen production pathways, particularly under different growth conditions.

How do mutations in kdpC affect membrane potential and bioenergetics in R. sphaeroides?

Mutations in the catalytic domains of kdpC would be expected to affect:

  • ATP hydrolysis efficiency

  • Coupling between ATP hydrolysis and ion transport

  • Proton/potassium gradients across the membrane

  • Cellular energy homeostasis

Studying these effects requires specialized bioenergetic techniques including membrane potential measurements, ATP synthesis/hydrolysis assays, and growth studies under varying ionic conditions. The essential nature of these systems in related species suggests that complete loss-of-function mutations might not be viable without compensatory mechanisms .

What are the optimal conditions for recombinant kdpC expression in heterologous systems?

For optimal recombinant expression of R. sphaeroides kdpC in heterologous systems, researchers should consider multiple factors that influence protein production and functionality:

ParameterRecommendationRationale
Expression hostE. coli BL21(DE3) or R. sphaeroides strain lacking endogenous kdpCMinimizes interference with native systems
Growth temperature28-30°CBalances protein production with proper folding
InductionModerate induction (0.1-0.5 mM IPTG for T7 systems)Prevents formation of inclusion bodies
Media compositionSupplemented with potassium at physiological levelsSupports proper protein folding and activity
Co-expressionConsider co-expressing kdpA and kdpB subunitsEnhances proper complex formation
Harvest timingLate log phaseOptimizes protein yield and quality

When designing expression systems, researchers should consider that membrane proteins like those in ATPase complexes often require specialized approaches. The methodology used for creating gene constructs should follow similar approaches to those used in related studies, where gene transfer agent transduction combined with conjugation has been successful for manipulating challenging gene systems .

How should researchers design experiments to study the role of kdpC in metabolic engineering applications?

Designing effective experiments to study kdpC in metabolic engineering requires a systematic approach:

  • Baseline characterization: Establish wild-type performance metrics for growth, ATP levels, membrane potential, and target metabolite production (e.g., CoQ10 or H2).

  • Genetic manipulation strategy:

    • For overexpression studies, use inducible promoters with varying strengths

    • For deletion/mutation studies, consider the essential nature of ATPase genes and employ conditional systems or partial disruptions

    • Use gene transfer agent transduction combined with conjugation for difficult-to-manipulate essential genes

  • Experimental controls:

    • Include empty vector controls for overexpression studies

    • Include complementation with wild-type kdpC for mutation studies

    • Consider overexpressing other components of the energy metabolism pathway as comparison points

  • Analytical methods:

    • Employ completely randomized design (CRD) for initial screening

    • Use randomized block design (RBD) when environmental factors might influence outcomes

    • Consider Latin square design when multiple variables need to be controlled simultaneously

  • Data collection timeline:

    • Monitor growth kinetics throughout the experiment

    • Assess target metabolite production at multiple time points

    • Measure enzyme activity at key growth phases

This methodological framework provides rigorous assessment of kdpC's role while controlling for confounding variables that might influence metabolic outputs.

What statistical approaches are most appropriate for analyzing data from kdpC manipulation experiments?

The appropriate statistical approaches for analyzing kdpC manipulation experiments depend on the experimental design and research questions. Based on experimental design principles:

For single-factor experiments comparing different kdpC variants:

  • Analysis of Variance (ANOVA) is appropriate when comparing multiple treatments (e.g., wild-type, overexpression, and different mutations)

  • Post-hoc tests such as Tukey's HSD should be employed to identify specific differences between treatments

  • Effect size calculations provide insight into the magnitude of observed differences

For multi-factor experiments investigating kdpC alongside other variables:

  • Factorial ANOVA enables analysis of main effects and interactions between factors

  • In cases where complete randomization is not possible, randomized block design analysis removes block effects from experimental error

  • When three factors are being investigated simultaneously, Latin Square Design may be appropriate, particularly if the number of treatments equals the number of blocks

For time-course experiments:

  • Repeated measures ANOVA or mixed-effects models account for temporal correlation

  • Growth curve analysis using non-linear regression models can capture dynamic responses

Statistical analysis should include:

  • Assessment of data normality and homogeneity of variance

  • Appropriate transformation of data when assumptions are violated

  • Calculation of confidence intervals for parameter estimates

  • Power analysis to ensure adequate sample size

How can researchers effectively combine genetic and biochemical approaches to characterize kdpC function?

An integrated approach combining genetic and biochemical methods provides comprehensive characterization of kdpC function:

Genetic approaches:

  • Site-directed mutagenesis targeting conserved residues in functional domains

  • Creation of chimeric proteins with homologous kdpC from related species

  • Conditional expression systems to regulate kdpC levels temporally

  • CRISPR-Cas9 genome editing for precise chromosomal modifications

Biochemical approaches:

  • Purification of recombinant kdpC using affinity tags with careful consideration of detergents for membrane protein solubilization

  • ATPase activity assays measuring phosphate release or ATP consumption rates

  • Reconstitution of purified kdpC into liposomes to assess transport function

  • Structural studies using X-ray crystallography or cryo-EM

Integration strategies:

  • Create genetic variants based on biochemical hypotheses

  • Express and purify the variants for in vitro characterization

  • Reintroduce characterized variants into cells to assess in vivo function

  • Correlate biochemical parameters with cellular phenotypes

This bidirectional approach between genetics and biochemistry provides mechanistic understanding while confirming biological relevance. For essential genes like those in the ATP synthase complex, researchers should consider the method described for R. capsulatus, which combines gene transfer agent transduction with conjugation to construct strains carrying mutations in indispensable genes .

What are the challenges in isolating functional recombinant kdpC and how can they be overcome?

Isolating functional recombinant kdpC presents several challenges due to its nature as a membrane-associated ATPase component:

ChallengeSolution StrategyImplementation Details
Membrane protein solubilityOptimize detergent selectionScreen mild detergents (DDM, LMNG) at concentrations just above CMC
Maintaining native conformationInclude stabilizing lipidsSupplement with E. coli polar lipids or synthetic lipids matching R. sphaeroides composition
Low expression yieldsOptimize codon usage and expression conditionsUse R. sphaeroides-optimized codons; test various temperatures (18-30°C) and induction levels
Potential toxicity to host cellsUse tightly regulated expression systemsEmploy repressible promoters and consider lower-copy-number vectors
Assessing functionalityDevelop robust activity assaysMeasure ATPase activity through phosphate release assays; use potassium-sensitive fluorescent probes
Complex formation requirementsCo-express interacting partnersConsider co-expression with kdpA and kdpB for proper complex assembly
Protein degradationInclude protease inhibitorsUse cocktails containing PMSF, leupeptin, and pepstatin during purification

When overcoming these challenges, researchers should consider that experimentation with essential genes like those encoding ATP synthase components may require specialized genetic approaches. For instance, in R. capsulatus, researchers found it was not possible to obtain viable cells carrying ATP synthase gene deletions, suggesting these genes are essential under standard growth conditions . This necessitates the development of conditional systems or alternative genetic manipulation strategies.

How do post-translational modifications affect kdpC activity, and how can researchers investigate these effects?

Understanding post-translational modifications (PTMs) of kdpC and their functional impacts requires specialized analytical approaches:

Potential PTMs affecting kdpC:

  • Phosphorylation of specific residues in regulatory domains

  • Glycosylation affecting protein stability or interactions

  • Lipid modifications influencing membrane association

  • Proteolytic processing for activation or regulation

Investigative methodologies:

  • PTM identification:

    • Mass spectrometry-based proteomics with enrichment strategies for specific modifications

    • Western blotting with modification-specific antibodies

    • Radiolabeling approaches for dynamic studies

  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues (e.g., phosphomimetic mutations)

    • In vitro enzymatic assays comparing modified and unmodified forms

    • Structural analysis to identify conformational changes upon modification

  • Regulatory dynamics:

    • Time-course studies under different growth conditions

    • Inhibitor studies targeting specific modification enzymes

    • Correlation of modification status with cellular energy state

  • Experimental design considerations:

    • Growth conditions significantly impact PTM profiles

    • Sample preparation must preserve labile modifications

    • Quantitative approaches should include appropriate normalization

While specific information about PTMs on R. sphaeroides kdpC is not detailed in the search results, the approaches outlined above provide a framework for investigating this important regulatory dimension. Studies on related ATP-dependent systems suggest that phosphorylation in particular may play key roles in regulating activity in response to environmental conditions.

What are the most promising research directions for understanding kdpC function in R. sphaeroides?

Future research on kdpC in R. sphaeroides should focus on several promising directions:

  • Systems biology integration: Investigating how kdpC functions within the broader network of energy metabolism, particularly in relation to hydrogen production pathways and CoQ10 biosynthesis .

  • Structural biology: Determining high-resolution structures of kdpC alone and in complex with interaction partners to elucidate mechanistic details of ATP hydrolysis and ion transport.

  • Synthetic biology applications: Exploring kdpC engineering for enhanced bioenergy production, particularly in developing strains with improved hydrogen production capabilities under various conditions .

  • Comparative genomics: Examining kdpC evolution across different Rhodobacter species and strains to understand structural and functional conservation patterns, similar to comparative analyses performed with ATP synthase genes in R. capsulatus .

  • Environmental adaptation: Investigating how kdpC function and regulation respond to changing environmental conditions, particularly factors relevant to bioenergy production applications.

These research directions will benefit from the complete genome sequence information available for R. sphaeroides strains like KD131 , facilitating targeted genetic and proteomic studies to elucidate the role of kdpC in cellular energy metabolism and biotechnological applications.

How can researchers effectively collaborate across disciplines to advance knowledge of kdpC function?

Effective cross-disciplinary collaboration for kdpC research requires structured approaches:

  • Integration of expertise:

    • Molecular biologists for genetic manipulation and expression

    • Biochemists for protein purification and functional characterization

    • Structural biologists for three-dimensional analysis

    • Bioinformaticians for sequence and systems-level analysis

    • Bioprocess engineers for scale-up and application development

  • Collaborative experimental design:

    • Establish shared research questions addressing multiple disciplinary interests

    • Employ statistical designs that satisfy requirements across fields

    • Develop standardized protocols for consistent data generation

    • Implement randomized block designs when different laboratories contribute to the same study

  • Data integration frameworks:

    • Create unified databases connecting genetic, biochemical, and physiological data

    • Develop visualization tools that communicate effectively across disciplines

    • Establish common terminology and reporting standards

    • Implement quality control metrics relevant to multiple disciplines

  • Knowledge transfer mechanisms:

    • Organize workshops bringing together diverse expertise

    • Develop cross-training opportunities for researchers

    • Create collaborative publication strategies targeting diverse audiences

    • Establish regular communication channels for ongoing projects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.