Recombinant Rhodobacter sphaeroides Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Recombinant Production in Rhodobacter sphaeroides

Recombinant lgt from R. sphaeroides is produced for structural and functional studies. Common hosts include E. coli and yeast, with varying tags and expression systems:

ConstructHostTagPurityExpression VectorSource
Partial lgt (1–292 aa)YeastN/A>85% (SDS-PAGE)pUC18, pBAD18s, pAM238
Full-length lgt (1–292 aa)E. coliHis-tag>85% (SDS-PAGE)pRSET-mCherry, custom vectors
lgt with c-myc tagsE. colic-myc (double)>85% (SDS-PAGE)pUC18, pBAD18s-Cm

Key observations:

  • Host Versatility: R. sphaeroides lgt is functional in E. coli, enabling complementation assays for studying lipoprotein maturation .

  • Tag Selection: His-tags facilitate affinity purification, while c-myc tags aid immunodetection .

Lipoprotein Biosynthesis

In R. sphaeroides, lgt operates alongside signal peptidase II (Lsp) and N-acyltransferase (Lnt) to process prolipoproteins into triacylated forms. Deletion of lgt in E. coli results in growth defects, highlighting its essential role .

Recombinant Expression Challenges

  • Membrane Localization: The enzyme’s multi-pass transmembrane structure complicates solubilization and purification. Detergents like N-octyl-β-d-glucoside are used to maintain activity .

  • Substrate Specificity: lgt exclusively utilizes phosphatidylglycerol as a lipid donor, limiting its applications in heterologous systems without compatible lipid synthesis pathways .

Biotechnological Potential

  1. Antibacterial Target: lgt is conserved in Gram-negative and Gram-positive bacteria. Inhibitors targeting lgt could disrupt lipoprotein biogenesis, offering novel antimicrobial strategies .

  2. Membrane Protein Production: R. sphaeroides’s photosynthetic membranes provide a high surface area for expressing recombinant lgt and other membrane proteins, as demonstrated in GPCR production studies .

Research Gaps and Future Directions

  • Structural Characterization: No crystal or cryo-EM structures of R. sphaeroides lgt are available. Solving its structure would elucidate substrate-binding mechanisms.

  • In Vivo Function: The role of lgt in R. sphaeroides’s metabolic pathways (e.g., hydrogen production, terpene biosynthesis) remains unexplored .

  • Synthetic Biology: Engineering lgt variants with altered substrate specificity could enable tailored lipid modifications in bioengineered strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lgt; Rsph17025_0260; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Target Names
lgt
Target Protein Sequence
MSYIPFPDISPEIFSVELFGATFALRWYALAYIAGLLIGWRLVLRMIRSDRLWTFGAPMT EDQLERLLTWVILGVILGGRLGFVLFYQPSHYLAHPLDALKVWEGGMSFHGGFLGVMVAV IAFCLRERISILPVADLLAAATPPGLFLGRIANFINAELWGRPTTLPWGVAFPGEAAQTC PGIEGICARHPSQLYEAALEGIVLFAILAILIWRRGWLRWPGAVTGAFLAGYGCARFLVE FVRQPDAQFVTPGNPLGLAWEIGGYGLTMGQILSLPMILLGLYFMLRARRTA
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in mature lipoprotein formation.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its primary function in bacteria?

Prolipoprotein diacylglyceryl transferase (lgt) is a membrane-bound enzyme that catalyzes the first step in the post-translational modification of bacterial lipoproteins. Its primary function is to transfer an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine residue in the lipobox motif of prolipoproteins . This reaction results in the formation of a thioether-linked diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product . This modification is crucial for proper anchoring of lipoproteins to the bacterial membrane and represents the initial step in a three-part modification process that continues with signal peptide cleavage by signal peptidase II (Lsp).

How is the lgt protein structurally organized in bacterial membranes?

Lgt is an inner membrane protein with a complex topology. Research on Escherichia coli lgt, which shares significant homology with Rhodobacter sphaeroides lgt, has demonstrated that the protein is embedded in the membrane by seven transmembrane segments . Its N-terminus faces the periplasm, while its C-terminus is oriented toward the cytoplasm . This topology has been determined through complementary approaches including:

  • Fusion protein analysis with β-galactosidase and alkaline phosphatase

  • Substituted cysteine accessibility method (SCAM) studies

  • Computational prediction validated by experimental data

This organization positions the catalytic residues appropriately for accessing both the membrane phospholipid substrate and the prolipoprotein target.

What conserved sequence features characterize the lgt protein family?

Lgt proteins across diverse bacterial species contain several highly conserved sequence features that are critical for function. These include:

  • The "Lgt signature motif" containing four invariant residues that face the periplasmic space

  • Multiple sequence alignment of lgt from E. coli, S. typhimurium, H. influenzae, and S. aureus has revealed regions of highly conserved amino acid sequences throughout the molecule

  • The longest set of identical amino acids without any gap is H-103-GGLIG-108 in lgt from these four microorganisms

How do mutations in conserved lgt residues affect enzyme function and bacterial viability?

Research has demonstrated that specific conserved amino acid residues are critical for lgt function. Studies involving alanine substitution of conserved residues in E. coli lgt identified several key findings applicable to Rhodobacter sphaeroides research:

  • Residues Y26, N146, and G154 are absolutely required for lgt function, as alanine substitutions at these positions completely abolished activity

  • Residues R143, E151, R239, and E243 are important but not absolutely essential, as their substitution significantly reduced but did not eliminate activity

  • In E. coli lgt mutant SK634, substitution of Gly-104 to Ser in the conserved H-103-GGLIG-108 region resulted in temperature-sensitive growth and exhibited low lgt activity in vitro

These findings indicate that the majority of essential residues are located within the membrane segments, with the lgt signature motif positioned to face the periplasm where the catalytic activity occurs . When designing mutational studies for Rhodobacter sphaeroides lgt, researchers should prioritize these highly conserved residues.

What methods can be employed to characterize the enzymatic activity of recombinant lgt in vitro?

Several methodological approaches have proven effective for characterizing lgt enzymatic activity:

  • In vitro assays using purified recombinant enzyme and synthetic prolipoprotein substrates

  • Chemical modification studies, such as those with diethylpyrocarbonate which inactivates E. coli lgt with a second-order rate constant of 18.6 M⁻¹s⁻¹

  • Hydroxylamine reversibility tests to confirm specific residue modification

  • Complementation assays using temperature-sensitive lgt mutants (e.g., E. coli strain SK634)

When designing activity assays for Rhodobacter sphaeroides lgt, researchers should consider:

  • Using phosphatidylglycerol as the donor substrate

  • Employing synthetic peptides containing the lipobox motif [L-A(S)-G(A)-C] as acceptor substrates

  • Monitoring both diacylglyceryl-prolipoprotein formation and glycerolphosphate release

  • Controlling reaction conditions to maintain membrane protein integrity

How does the structure-function relationship of lgt differ between Gram-positive and Gram-negative bacteria?

The structure-function relationship of lgt shows both conservation and divergence between Gram-positive and Gram-negative bacteria:

  • Sequence comparison between S. aureus (Gram-positive) and E. coli (Gram-negative) lgt reveals 24% identity and 47% similarity

  • The S. aureus lgt protein is 12 amino acids shorter than its E. coli counterpart but maintains a similar hydropathic profile and predicted isoelectric point (pI ≈ 10.4)

  • Despite sequence divergence, both enzymes recognize similar substrate motifs and catalyze identical reactions

This comparative data suggests that while the core catalytic machinery is conserved, species-specific adaptations have evolved. For researchers working with Rhodobacter sphaeroides lgt, understanding these differences is crucial when extrapolating findings across bacterial species.

What expression systems are most effective for producing functional recombinant Rhodobacter sphaeroides lgt?

Based on the available research data, effective expression systems for Rhodobacter sphaeroides lgt should consider:

  • Membrane protein expression challenges

    • Use of bacterial hosts with enhanced membrane protein expression capabilities

    • Inducible promoter systems for controlled expression

    • Fusion tags that aid in membrane insertion and purification

  • Expression conditions optimization

    • Temperature modulation (typically lower temperatures of 16-20°C)

    • Inducer concentration titration

    • Growth media supplementation with phospholipids

  • Purification strategy

    • Mild detergent solubilization (e.g., n-dodecyl-β-D-maltoside)

    • Affinity chromatography using His-tag or other suitable tags

    • Size exclusion chromatography for final polishing

For storage, the recombinant protein should be maintained in Tris-based buffer with 50% glycerol at -20°C, with extended storage at -80°C recommended to preserve activity .

How can researchers design assays to evaluate substrate specificity of Rhodobacter sphaeroides lgt?

To effectively evaluate substrate specificity of Rhodobacter sphaeroides lgt, researchers can implement the following assay designs:

  • Prolipoprotein substrate variation assays:

    • Synthetic peptides with systematic variations in the lipobox motif [L-A(S)-G(A)-C]

    • Natural prolipoprotein substrates from Rhodobacter and heterologous sources

    • Competition assays between different substrates

  • Phospholipid donor substrate assays:

    • Various phospholipid classes beyond phosphatidylglycerol

    • Variations in acyl chain length and saturation

    • Labeled phospholipids for sensitive detection of transfer

  • Kinetic parameter determination:

    • Initial velocity measurements at varying substrate concentrations

    • Inhibition studies with substrate analogs

    • Competition experiments to determine relative substrate preferences

A typical experimental setup would include purified recombinant lgt reconstituted in liposomes or detergent micelles, synthetic prolipoprotein substrates, and analytical methods such as thin-layer chromatography, mass spectrometry, or fluorescence-based assays to monitor reaction progress.

How should researchers interpret evolutionary conservation patterns in lgt across bacterial species?

The interpretation of evolutionary conservation patterns in lgt requires multifaceted analysis:

  • Sequence conservation analysis:

    • Multiple sequence alignment of lgt from diverse bacterial species reveals highly conserved regions

    • The H-103-GGLIG-108 motif shows complete conservation across E. coli, S. typhimurium, H. influenzae, and S. aureus

    • Conservation patterns correlate with functional importance, as demonstrated by mutational studies

  • Structure-based interpretation:

    • Mapping conserved residues to the predicted membrane topology

    • Identification of conservation patterns in transmembrane versus loop regions

    • Correlation between conservation and proximity to the active site

  • Phylogenetic analysis considerations:

    • Separation of Gram-positive and Gram-negative bacterial lgt sequences

    • Consideration of evolutionary distance when comparing specific residue functions

    • Assessment of co-evolution with substrate lipoproteins

When analyzing Rhodobacter sphaeroides lgt, researchers should note that while it shares the core conserved motifs with other bacterial lgt proteins, species-specific variations may reflect adaptation to particular membrane environments or substrate preferences.

What computational approaches can be used to predict substrate interactions with Rhodobacter sphaeroides lgt?

Several computational approaches can be employed to predict substrate interactions:

  • Homology modeling:

    • Using E. coli lgt as a template structure

    • Refinement focusing on conserved catalytic residues

    • Validation through comparison with experimental mutagenesis data

  • Molecular docking simulations:

    • Docking of phosphatidylglycerol into the putative binding site

    • Docking of prolipoprotein substrate peptides

    • Analysis of binding energy and interaction surfaces

  • Molecular dynamics simulations:

    • Modeling the enzyme embedded in a lipid bilayer

    • Simulating the approach and binding of substrates

    • Analyzing conformational changes during the catalytic cycle

  • Machine learning approaches:

    • Training on known lgt-substrate interactions

    • Feature extraction from sequence and structural data

    • Prediction of novel substrate compatibility

These computational predictions should be validated through experimental approaches such as site-directed mutagenesis, chemical modification studies, and in vitro activity assays.

What strategies can address challenges in obtaining enzymatically active recombinant lgt?

Researchers often encounter challenges in obtaining active recombinant membrane proteins like lgt. These challenges can be addressed through:

  • Expression optimization:

    • Codon optimization for the expression host

    • Use of specialized strains designed for membrane protein expression

    • Fusion to solubility-enhancing tags (MBP, SUMO) that can be cleaved post-purification

  • Protein stability enhancement:

    • Addition of stabilizing lipids during purification

    • Screening various detergents for optimal solubilization

    • Use of nanodiscs or liposomes for functional reconstitution

  • Activity preservation techniques:

    • Avoiding freeze-thaw cycles by working with aliquots

    • Including glycerol (50%) in storage buffers

    • Maintaining proper pH and ionic strength conditions

  • Quality control assays:

    • Circular dichroism to verify secondary structure integrity

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to optimize buffer conditions

If activity issues persist, co-expression with bacterial chaperones or expression in a native-like membrane environment might improve functional yields.

How can researchers differentiate between effects on catalysis versus substrate binding when analyzing lgt mutants?

Distinguishing catalytic from binding effects requires systematic analytical approaches:

  • Kinetic parameter analysis:

    • Measurement of Km (substrate affinity) and kcat (catalytic rate) separately

    • Comparison of these parameters between wild-type and mutant enzymes

    • Analysis of product inhibition patterns

  • Direct binding assays:

    • Surface plasmon resonance with immobilized enzyme or substrate

    • Isothermal titration calorimetry to measure binding thermodynamics

    • Fluorescence-based binding assays with labeled substrates

  • Structural analysis techniques:

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

    • Cross-linking studies to identify interaction sites

    • Spectroscopic methods to detect substrate-induced conformational changes

  • Computational validation:

    • Molecular dynamics simulations of wild-type and mutant enzymes

    • Quantitative structure-activity relationship (QSAR) analysis

    • Free energy calculations for substrate binding

By integrating these approaches, researchers can develop a comprehensive understanding of how specific mutations affect the distinct stages of the lgt reaction cycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.