Recombinant Rhodobacter sphaeroides Protein rdxB (rdxB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant RdxB

Recombinant RdxB is produced in E. coli with an N-terminal His tag for purification. Key specifications include:

PropertyDetails
SourceRhodobacter sphaeroides (strain 2.4.1)
Expression HostE. coli
Protein Length477 amino acids (Full-length)
Molecular FeaturesContains two [4Fe-4S] clusters; predicted membrane-bound topology
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
SequenceMTSPDTQTSSLYAKREPVFPKRVSGKFRSLKWWIMGVTLGIYYIAPWLRWDR... (Full sequence available in )

Redox Regulation and Photosynthesis

  • RdxB interacts directly with the cbb<sub>3</sub> cytochrome oxidase, a heme-copper oxidase critical for microaerobic respiration .

  • Mutations in rdxB lead to aerobic derepression of photosynthesis genes (puc and puf operons), indicating its role in oxygen-dependent regulatory pathways .

  • Carotenoid Conversion: RdxB mutants exhibit enhanced conversion of spheroidene to spheroidenone, linked to altered redox states in the cbb<sub>3</sub> oxidase .

Operon Interactions

The rdxBHIS operon is cotranscribed with the ccoNOQP operon (cbb<sub>3</sub> oxidase genes) . Key interactions include:

  • RdxH/I/S: Posttranscriptionally stabilize cbb<sub>3</sub> oxidase activity, likely via copper homeostasis (RdxI is a CPx-type ATPase metal transporter) .

  • FnrL Dependency: Transcription of ccoNOQP-rdxBHIS is regulated by FnrL, linking oxygen sensing to photosystem gene expression .

Genetic Mutagenesis Studies

MutationPhenotypeMechanism
ΔrdxB- 2-fold increase in puc/puf expression under aerobic conditions
- Altered Crt redox state
Direct disruption of cbb<sub>3</sub> oxidase electron flow
ΔrdxH/I/S- Reduced cbb<sub>3</sub> activity (20–30% residual)
- 33–47% loss of cytochrome b/c content
Impaired Cu delivery or oxidase assembly via RdxI-mediated transport

Biochemical Analyses

  • Western Blots: RdxH/I/S mutants show reduced CcoO/P polypeptide levels, despite intact transcription .

  • Cytochrome Spectra: b- and c-type cytochrome levels correlate with cbb<sub>3</sub> activity, confirming posttranslational defects in mutants .

Applications and Implications

  • Redox Signaling: RdxB is a model for studying redox-regulated photosynthesis in α-proteobacteria .

  • Biotechnological Use: Recombinant RdxB serves as a tool for probing metalloprotein assembly and electron transport mechanisms .

  • Copper Homeostasis: Insights into RdxI’s CPx-type ATPase function may inform engineering of metal-resistant bacterial strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
rdxB; RHOS4_23000; RSP_0692; Protein RdxB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-477
Protein Length
full length protein
Species
Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Target Names
rdxB
Target Protein Sequence
MTSPDTQTSSLYAKREPVFPKRVSGKFRSLKWWIMGVTLGIYYIAPWLRWDRGPNLPDQA ILVDLANRRFFFFMIEIWPHEFYFVAGLLIMAGLGLFLFTSAAGRVWCGYACPQTVWTDL FILVERWVEGDRNARIRLLRQRWDLEKTRKYLTKWTLWLLIGLATGGAWVFYFTDAPTLL VDLLTGNAHPVAYITMATLTATTFAFGGFAREQICIYACPWPRIQAAMMDEETITVAYRE WRGEPRGKLKKGEPLSPDQGDCIDCMACVNVCPMGIDIRDGQQLACITCALCIDACDEVM DKIGKPRGLIGYLALTDERAEREGRSPRSAWRHVFRLRTLIYTALWSGVGLALIVALFLR SPIDINVTPLRNPLYVTLSDGSIRNTYDVRLRNKQGEARDYQISVTSEADLALSLEGHPA TVVTVPANETMTQRVYIIAGKGTPAAEAERTDLRLWVEDLAAGQRVHHDTIFNGRGN
Uniprot No.

Target Background

Function
RdxB plays a role in a membrane-generated redox signal and is essential for maintaining repression of photosynthesis gene expression in the presence of oxygen.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the rdxB protein in Rhodobacter sphaeroides?

RdxB is a membrane-bound protein in Rhodobacter sphaeroides containing two [4Fe-4S] centers that functions as part of the rdxBHIS operon. It plays a critical role in the aerobic regulation of photosystem gene expression in this photosynthetic bacterium. The protein appears to be a redox-active component that interacts with the cbb3 cytochrome oxidase, influencing photosynthetic gene expression through redox-based signaling mechanisms. Unlike some other components of the rdx operon, RdxB exerts a more direct effect on photosystem gene expression through this interaction .

The importance of rdxB stems from R. sphaeroides' status as the most widely studied model organism in bacterial photosynthesis research. This purple phototrophic bacterium is exceptionally versatile, capable of growing through five different metabolic modes: photoautotrophically, photoheterotrophically, chemolithotrophically, by respiration, or by fermentation of organic compounds .

How does rdxB regulate photosynthesis gene expression?

RdxB regulates photosynthesis gene expression through redox-based mechanisms that are particularly active under aerobic conditions. Studies using puc and puf operon lacZ fusions have demonstrated that deletion mutations in rdxB result in significantly increased photosynthesis gene expression under aerobic conditions, suggesting that rdxB normally acts as a repressor of photosynthesis genes when oxygen is present .

The regulatory mechanism appears to involve direct interaction between RdxB and the cbb3 cytochrome oxidase. Unlike mutations in rdxH, rdxI, or rdxS that affect photosystem gene expression indirectly through posttranscriptional effects on cbb3 cytochrome oxidase structure and integrity, RdxB seems to have a more direct regulatory role. The two [4Fe-4S] centers in RdxB likely function as redox sensors that detect changes in cellular oxygen levels or redox status, translating these environmental signals into altered photosynthesis gene expression .

What phenotypic changes are associated with rdxB mutations?

Mutations in the rdxB gene result in several distinct phenotypic changes in R. sphaeroides:

  • Increased aerobic expression of photosynthesis genes, as demonstrated through lacZ fusion studies with the puc and puf operons .

  • Enhanced conversion of the carotenoid spheroidene to spheroidenone. This phenotype is also observed in RdxH, RdxI, and RdxS mutant strains and is likely related to the role of the rdxBHIS locus in cbb3 oxidase activity and/or structure .

  • Changes in cytochrome content and activity. While rdxB mutations don't significantly alter the levels of b-type and c-type cytochromes (unlike mutations in rdxH, rdxI, and rdxS which reduce these cytochromes by 33.9-47.3%), they do affect the interaction with cbb3 oxidase .

These phenotypic changes highlight the multifaceted role of rdxB in both photosynthesis regulation and carotenoid metabolism in R. sphaeroides.

What experimental designs are most effective for studying rdxB function?

Effective experimental designs for studying rdxB function in R. sphaeroides integrate multiple approaches:

Genetic Manipulation Strategies:
The creation of non-polar, in-frame deletion mutations in rdxB has proven highly effective for studying its function. This approach preserves the expression of downstream genes in the rdxBHIS operon, allowing researchers to attribute observed phenotypes specifically to the absence of rdxB rather than polar effects on rdxH, rdxI, or rdxS .

Reporter Gene Fusion Assays:
Using puc and puf operon lacZ fusions to monitor photosystem gene expression provides quantitative data on the regulatory effects of rdxB mutations. This method allows for precise measurement of gene expression under various growth conditions, particularly important for assessing the aerobic regulation function of rdxB .

Experimental Design Principles:
True experimental design with appropriate controls is essential. This should include:

  • Clear identification of independent variables (e.g., growth conditions, genetic backgrounds) and dependent variables (e.g., photosynthesis gene expression, carotenoid conversion)

  • Control groups (wild-type strains) versus experimental groups (rdxB mutants)

  • Randomization to control for extraneous variables

  • Replication to ensure statistical validity

Biochemical and Spectroscopic Analysis:
Dithionite-reduced-minus-air-oxidized spectra of membrane fractions provide valuable data on cytochrome content and can reveal subtle phenotypic effects of rdxB mutations. Similarly, Western blot analysis using specific antisera (e.g., CcoO/P-specific antiserum) allows quantification of relevant protein levels .

How can the interaction between RdxB and cbb3 oxidase be characterized?

Characterizing the interaction between RdxB and cbb3 oxidase requires multiple complementary approaches:

Oxidase Activity Assays:
Measurement of cbb3-specific oxidase activity in membrane fractions from wild-type and rdxB mutant strains provides functional data on the impact of rdxB on cbb3 oxidase. This can be done using oxygen consumption assays with specific electron donors .

Protein-Protein Interaction Studies:
Co-immunoprecipitation using antibodies against RdxB or cbb3 oxidase components can demonstrate physical interaction between these proteins. Additionally, cross-linking studies followed by mass spectrometry could identify specific interaction domains.

Western Blot Analysis:
Quantification of cbb3 oxidase component levels using specific antisera (e.g., CcoO/P-specific antiserum) in wild-type versus rdxB mutant backgrounds can reveal whether rdxB affects the stability or assembly of the cbb3 oxidase complex. The data from RdxB mutants showed that CcoO/P-specific signals were present at similar levels to wild-type 2.4.1, suggesting that RdxB does not affect the physical presence of cbb3 components but rather their activity or function .

Spectroscopic Analysis:
Dithionite-reduced-minus-air-oxidized spectra provide information on b-type and c-type cytochrome content. In RdxB mutants, the levels of these cytochromes were similar to wild-type, unlike in RdxH, RdxI, and RdxS mutants where reductions were observed .

Strainb-type cytochrome reduction (%)c-type cytochrome reduction (%)
Wild-type 2.4.100
RdxB mutant~0~0
RdxH mutant33.947.3
RdxI mutant33.944.6
RdxS mutant33.945.9

This data table demonstrates that RdxB has distinct effects compared to other rdx operon components, supporting a direct rather than structural role in cbb3 oxidase function .

What techniques are available for analyzing the redox properties of the RdxB [4Fe-4S] centers?

Analysis of the redox properties of the [4Fe-4S] centers in RdxB requires specialized techniques:

Electron Paramagnetic Resonance (EPR) Spectroscopy:
EPR can detect unpaired electrons in the [4Fe-4S] clusters, allowing determination of the redox state of these centers under various conditions. By monitoring changes in EPR signals during redox titrations, the midpoint potentials of the [4Fe-4S] centers can be established.

Protein Purification and Reconstitution:
Purification of recombinant RdxB under anaerobic conditions, followed by iron and sulfide quantification, can confirm the presence of the [4Fe-4S] centers. Reconstitution of the iron-sulfur clusters may be necessary if the protein is purified in a form lacking the complete centers.

Cyclic Voltammetry:
This electrochemical technique can determine the redox potentials of the iron-sulfur clusters in RdxB. By immobilizing the protein on an electrode surface, direct electron transfer can be measured, providing information on the redox properties of the [4Fe-4S] centers.

UV-Visible Spectroscopy:
Iron-sulfur proteins typically exhibit characteristic absorption spectra that change upon reduction or oxidation. Monitoring these spectral changes during redox titrations can provide complementary data to EPR studies.

The implementation of these techniques requires careful consideration of the experimental environment, as [4Fe-4S] clusters are oxygen-sensitive. Working under anaerobic conditions is typically necessary to preserve the integrity of these redox centers during analysis .

How do mutations in rdxB affect the photosynthetic apparatus beyond gene expression?

Mutations in rdxB impact the photosynthetic apparatus in several ways beyond direct effects on gene expression:

Carotenoid Conversion:
RdxB mutants show enhanced conversion of the carotenoid spheroidene to spheroidenone. This phenotype suggests that RdxB influences carotenoid metabolism, possibly through effects on redox balance or oxygen sensing mechanisms in the cell .

cbb3 Oxidase Activity:
While RdxB mutants maintain normal levels of cbb3 oxidase protein (as evidenced by CcoO/P-specific Western blot signals similar to wild-type), the activity of this complex may be altered. This suggests that RdxB influences the function rather than the abundance of cbb3 oxidase .

Cytochrome Content and Function:
Unlike mutations in rdxH, rdxI, and rdxS, rdxB mutations do not significantly reduce b-type and c-type cytochrome levels. This differential effect further supports the hypothesis that RdxB has a regulatory rather than structural role in the photosynthetic apparatus .

Light-Harvesting Complex Organization:
Given the importance of the light-harvesting-reaction center (LH1-RC) core complex in R. sphaeroides photosynthesis, rdxB mutations may indirectly affect the organization or efficiency of these complexes. R. sphaeroides features both monomeric and dimeric forms of the LH1-RC complex, with an unusual S-shaped LH1 structure that incorporates two RCs resulting in a dimeric LH1-RC complex .

These observations suggest that rdxB functions as part of a complex regulatory network connecting redox sensing, oxygen response, and photosynthetic apparatus function in R. sphaeroides.

What methodological challenges exist in purifying and characterizing the RdxB protein?

Purifying and characterizing RdxB presents several significant methodological challenges:

Membrane Protein Solubilization:
As a membrane-bound protein, RdxB requires careful selection of detergents for solubilization. The choice of detergent must balance efficient extraction with preservation of protein structure and activity. A systematic screening of detergents (e.g., DDM, LDAO, Triton X-100) at various concentrations is advisable.

Iron-Sulfur Cluster Stability:
The two [4Fe-4S] centers in RdxB are typically oxygen-sensitive, necessitating anaerobic conditions during purification and characterization. Loss of iron or cluster degradation during purification can compromise functional studies. Addition of reducing agents such as DTT or β-mercaptoethanol may help preserve cluster integrity.

Expression Systems:
Heterologous expression of membrane proteins with intact iron-sulfur clusters presents challenges. Expression in R. sphaeroides itself may be preferable to E. coli systems, as the native organism possesses the machinery for correct insertion of the protein into membranes and assembly of the iron-sulfur clusters.

Functional Reconstitution:
For activity assays, RdxB may need to be reconstituted into liposomes or nanodiscs to recreate a membrane environment. The lipid composition should ideally mimic that of R. sphaeroides membranes to ensure proper protein function.

Protein-Protein Interaction Studies:
Studying the interaction between RdxB and cbb3 oxidase requires both proteins to be in their native conformations. Co-purification approaches or in vitro reconstitution of the complex may be necessary to characterize this interaction fully.

These methodological challenges explain why structural studies of membrane proteins from R. sphaeroides, including components of the photosynthetic apparatus, have been difficult to obtain at high resolution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.