Recombinant Rhodobacter sphaeroides Reaction center protein M chain (pufM)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Rhodobacter sphaeroides Reaction Center Protein M Chain (pufM) is a critical component of the photosynthetic apparatus in this purple non-sulfur bacterium. As part of the Type II photosynthetic reaction center (RC), PufM works alongside PufL to form the core structure that facilitates light-driven electron transport . Recombinant production enables biochemical and structural studies, with applications in energy conversion research and synthetic biology .

Gene and Protein Structure

  • Gene: Encoded by the pufM gene within the puf operon (includes pufBALMX) .

  • Protein:

    • Length: 308 amino acids (UniProt ID: Q3J1A6) .

    • Domains: Transmembrane helices for bacteriochlorophyll binding .

    • Tags: Typically expressed with an N-terminal His tag for purification .

ParameterDetails
Host SystemEscherichia coli (common), yeast, or mammalian cells
Purity≥85% (validated by SDS-PAGE)
Molecular Weight~34 kDa (calculated)

Phylogenetic Context

  • PufM is evolutionarily conserved among Proteobacteria, with distinct clades in Alpha-, Beta-, and Gammaproteobacteria .

  • Phylogenetic analysis of pufLM genes supports vertical inheritance in most lineages, though lateral gene transfer is debated in Rhodospirillales .

Electron Transfer Mechanism

  • QB Site Dynamics: PufM mediates ubiquinone (Q) binding at the QB site, enabling electron transfer from the RC to the cytochrome bc₁ complex .

  • PufX Dependency: In vivo studies show PufX is required for efficient Q/QH₂ exchange at the QB site under reducing conditions . Deletion of pufX reduces exchange rates by ~500-fold .

Mutant Phenotypes

  • ΔpufM Strains: Fail to assemble functional RCs, resulting in photosynthetic incompetence .

  • Suppressor Mutants: Restore partial RC functionality by altering antenna complex organization .

Mutant TypePhenotypeSource
ΔpufLMXPS⁻ (unable to grow photoheterotrophically)
ΔpufXImpaired Q/QH₂ exchange under low redox potential

Expression Systems

  • E. coli: Most widely used for high-yield production (e.g., 2–308aa fragment with His tag) .

  • Alternative Hosts: Yeast and mammalian systems enable post-translational modifications .

Biotechnological Relevance

  • Bioenergy: Engineered RCs incorporating recombinant pufM are explored for solar energy harvesting .

  • Environmental Sensors: pufM primers enable detection of phototrophic bacteria in diverse ecosystems .

Challenges and Future Directions

  • Stability Issues: RC complexes require precise lipid environments for stability in vitro .

  • Engineering Goals: Enhancing Q-binding affinity in pufM could improve RC efficiency for synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
pufM; Reaction center protein M chain; Photosynthetic reaction center M subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-308
Protein Length
Full Length of Mature Protein
Species
Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides)
Target Names
pufM
Target Protein Sequence
AEYQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVLSL FSGLMWFFTIGIWFWYQAGWNPAVFLRDLFFFSLEPPAPEYGLSFAAPLKEGGLWLIASF FMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIF SHLDWTNNFSLVHGNLFYNPFHGLSIAFLYGSALLFAMHGATILAVSRFGGERELEQIAD RGTAAERAALFWRWTMGFNATMEGIHRWAIWMAVLVTLTGGIGILLSGTVVDNWYVWGQN HGMAPLN
Uniprot No.

Target Background

Function
The reaction center is a membrane-bound complex that plays a critical role in initiating the photochemical event within the electron transfer process of photosynthesis.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular chromatophore membrane; Multi-pass membrane protein.

Q&A

What is the pufM gene and what role does it play in the photosynthetic apparatus?

The pufM gene is part of the puf operon in Rhodobacter sphaeroides 2.4.1 and encodes the M polypeptide of the photosynthetic reaction center. The puf operon as a whole encodes several critical components of the photosynthetic apparatus, including the beta- and alpha-polypeptides of the B875 complex, the L and M polypeptides of the reaction center, and the pufX gene product . The M chain specifically functions as a core component of the photosynthetic reaction center complex, which is essential for the conversion of light energy to chemical energy in these photosynthetic bacteria. Understanding the structure and function of pufM is crucial for comprehending the mechanisms of bacterial photosynthesis and potential applications in synthetic biology and bioenergy research.

How is pufM expression regulated in Rhodobacter sphaeroides?

The expression of pufM is regulated through a complex translational control mechanism that involves upstream genetic elements. Research has demonstrated that a 20-codon open reading frame (orfK, now designated pufK) located immediately upstream of the pufB structural gene plays a critical role in this regulation . Experimental evidence suggests that translation initiation through pufK may be essential for the subsequent translation of pufB. Furthermore, the abundance, quality, and distribution of rare codons within pufK appear to serve as a "gating" mechanism that controls ribosomal entry at pufB . This sophisticated regulatory mechanism ensures appropriate stoichiometry of photosynthetic proteins under varying environmental conditions.

What are the recommended primer sets for detecting pufM genes in environmental samples?

For the detection of pufM genes in environmental samples, researchers have developed several targeted primer sets optimized for different ecological contexts. When designing experiments to detect pufM in environmental samples, it is essential to select primer sets appropriate for the specific environment being studied. The following primer sets have been validated for various ecological niches:

  • Rhodoferax-like pufM primers: Specifically designed to target genes in representative freshwater aerobic anoxygenic phototrophic (AAP) bacteria. These primers exactly match sequence coding for the N-terminal end of the DelRiverFos06H03 product .

  • Rhodobacter-like pufM primers: Designed to target estuarine types of pufM, particularly those found in the fosmid clone DelRiverFos13D03 .

  • Delaware marine group primers: Optimized to target a dominant group of pufM genes (representing approximately 37% of sequences) found in the Delaware Bay library .

For environmental detection protocols, these primers have been successfully employed to identify purple anoxyphototrophs in diverse habitats, including Yellowstone's New Pit Spring and microbial mat samples from Lakes Fryxell and Hoare in Antarctica . When implementing these primers in environmental studies, it is advisable to include positive controls by spiking environmental soil samples with cells from pure cultures of anoxyphototrophs to confirm detection efficacy .

How can quantitative PCR be optimized for pufM detection and quantification?

Quantitative PCR (qPCR) provides a powerful approach for both detecting and quantifying pufM genes in environmental samples. For optimal qPCR performance with pufM targets, researchers should implement the following methodological considerations:

For environmental studies aiming to characterize the abundance and distribution of pufM ecotypes, it is advisable to employ multiple primer sets targeting different pufM variants to ensure comprehensive coverage of the diversity present in the sample.

How can researchers address contradictory results when analyzing pufM expression data?

When confronted with contradictory results in pufM expression studies, researchers should implement a systematic approach to measure and analyze inconsistent information. The following methodological framework can help resolve apparent contradictions:

  • Quantify the degree of contradiction: Move beyond the binary classification of data as either consistent or inconsistent by employing fine-grained measures of contradiction that reflect the extent of discrepancy . This involves analyzing whether contradictions arise from fundamental incompatibilities in the underlying data or from methodological differences.

  • Evaluate source reliability: When integrating data from multiple sources (e.g., different research groups, literature reports), assess the relative reliability of each source based on the internal consistency of their data . Identify the source with minimal inconsistency in their pufM expression data as potentially the most reliable reference point.

  • Context-dependent analysis: Consider whether contradictions might reflect genuine biological variability rather than methodological errors. For example, variations in pufM expression under different growth conditions might reflect real physiological responses rather than experimental inconsistencies .

  • Balance information content with contradiction level: When deciding whether to incorporate potentially contradictory data, consider both the quantity of information provided and the degree of contradiction . High-quality datasets with minor contradictions may still offer valuable insights despite some inconsistencies.

This approach moves beyond simply rejecting contradictory data and instead treats inconsistencies as potential sources of insight into the complex regulatory mechanisms governing pufM expression.

What statistical approaches are recommended for analyzing pufM diversity in environmental samples?

For analyzing pufM diversity in environmental samples, researchers should employ statistical approaches that account for the complexities of microbial community data:

  • Diversity metrics: Calculate alpha diversity indices (Shannon, Simpson) to quantify the diversity of pufM sequences within samples, and beta diversity metrics to compare diversity patterns across different environmental samples or conditions.

  • Multivariate statistical analysis: Implement ordination techniques such as non-metric multidimensional scaling (NMDS) or principal component analysis (PCA) to visualize relationships between pufM communities and environmental variables .

  • Phylogenetic analysis: Incorporate phylogenetic information into diversity analyses using metrics like UniFrac distance, which accounts for the evolutionary relationships between pufM sequences when comparing communities.

  • Sequence clustering approaches: Define operational taxonomic units (OTUs) or amplicon sequence variants (ASVs) using appropriate sequence similarity thresholds based on known evolutionary rates of pufM to facilitate comparative analyses across studies.

When designing sampling strategies for environmental pufM studies, ensure sufficient replication and appropriate spatial/temporal coverage to capture the true diversity present in the environment. This is particularly important given the observed variability in pufM distribution across different ecosystems, from freshwater to marine environments .

What are the key considerations for designing experiments to study pufM function?

Designing rigorous experiments to study pufM function requires careful consideration of multiple variables and controls:

  • Variable identification and control: Clearly define independent variables (e.g., light intensity, oxygen levels, nutrient availability) and dependent variables (e.g., pufM expression levels, photosynthetic efficiency) . For example, in studies examining pufM expression under different light conditions, precisely control light quality, intensity, and duration while monitoring both transcript and protein levels.

  • Hypothesis formulation: Develop specific, testable hypotheses based on existing knowledge of pufM function. For instance, a null hypothesis might state: "There is no difference in photosynthetic efficiency between wild-type R. sphaeroides and strains with specific pufM mutations under varying light intensities" .

  • Experimental treatments: Systematically manipulate independent variables to test hypotheses about pufM function. For example, create a series of site-directed mutations in pufM and characterize their effects on protein assembly and photosynthetic activity .

  • Control groups: Include appropriate controls in all experiments, such as wild-type strains for comparison with mutants, and mock treatments that control for all experimental manipulations except the variable being tested .

  • Biological replication: Ensure sufficient biological replication to account for natural variability in bacterial growth and gene expression. Statistical power calculations should guide the determination of appropriate sample sizes.

For studies specifically investigating translational control of pufM, consider using translational fusions with reporter genes (e.g., lacZ) both in trans and incorporated into the genome in single copy to evaluate the effects of specific mutations on translation efficiency .

How can researchers effectively design mutation studies to elucidate pufM structure-function relationships?

To design effective mutation studies that illuminate pufM structure-function relationships, researchers should implement the following methodological approach:

  • Rational mutation design: Base mutation selection on existing structural information, sequence conservation analysis, and computational predictions of functional domains. Focus on regions likely to be involved in cofactor binding, protein-protein interactions, or electron transfer.

  • Systematic mutation strategy: Rather than random mutagenesis, employ a systematic approach that creates specific mutations (substitutions, deletions, insertions) at defined positions to test specific hypotheses about structure-function relationships .

  • Phenotypic characterization: Develop a comprehensive suite of assays to characterize mutant phenotypes, including:

    • Spectroscopic analysis to assess cofactor binding and orientation

    • Electron transfer kinetics measurements

    • Protein stability and assembly assays

    • Photosynthetic growth rate determination

  • Translation efficiency assessment: For mutations that might affect translation, incorporate methods to directly measure translation rates, such as ribosome profiling or pulse-chase experiments .

When investigating the role of rare codons in pufM expression, consider creating a series of synonymous mutations that alter codon usage without changing the amino acid sequence . This approach can help distinguish between effects at the protein level and effects on translation efficiency or mRNA stability.

How can pufM be utilized as a molecular marker for studying phototroph diversity and evolution?

The pufM gene serves as an excellent molecular marker for studying the diversity and evolution of phototrophs due to its essential role in photosynthesis and its phylogenetic informativeness. Researchers can leverage pufM in several sophisticated ways:

  • Phylogenetic analysis: Construct phylogenetic trees based on pufM sequences to infer evolutionary relationships among phototrophs. The sequence conservation of functional domains combined with variable regions makes pufM particularly suitable for resolving relationships at various taxonomic levels .

  • Biogeographical studies: Use pufM sequences to track the distribution patterns of phototrophs across different geographical regions and environmental gradients. This approach has successfully revealed distinct ecotypes adapted to specific environments, such as freshwater, estuarine, and marine habitats .

  • Temporal monitoring: Implement time-series sampling and pufM sequencing to monitor changes in phototroph communities in response to seasonal variations, climate change, or anthropogenic disturbances. This longitudinal approach can reveal succession patterns and community resilience.

  • Functional diversity assessment: Combine pufM sequence analysis with spectroscopic or physiological characterization to correlate genetic diversity with functional diversity in photosynthetic mechanisms .

When designing primers for phylogenetic studies, researchers should carefully consider the trade-off between specificity and breadth of detection. While highly specific primers may provide more reliable amplification within a target group, broader primers may reveal unexpected diversity and novel lineages .

What are the current challenges and future directions in pufM research for understanding bacterial photosynthesis?

Current challenges and future directions in pufM research encompass several frontier areas:

  • Structural dynamics: While static structures of photosynthetic reaction centers have been determined, understanding the dynamic structural changes of the pufM-encoded protein during electron transfer remains challenging. Future research should employ time-resolved structural methods to capture these dynamics.

  • Environmental adaptation: How variations in pufM sequence relate to adaptation to different light environments or ecological niches remains incompletely understood. Comparative genomics approaches combined with physiological characterization of diverse isolates will help address this question .

  • Horizontal gene transfer: The extent and significance of horizontal gene transfer in the evolution of pufM genes across different bacterial lineages requires further investigation through comprehensive phylogenomic analyses.

  • Integration with other omics approaches: Future research should integrate pufM sequence data with transcriptomics, proteomics, and metabolomics to develop a systems-level understanding of photosynthetic regulation and function.

  • Single-cell approaches: Developing methods to analyze pufM expression and function at the single-cell level in environmental samples will provide insights into cell-to-cell heterogeneity and microenvironmental adaptation.

  • Synthetic biology applications: Engineering modified versions of pufM for enhanced photosynthetic efficiency or novel functions represents an exciting frontier with potential applications in sustainable energy production .

Addressing these challenges will require interdisciplinary approaches combining molecular biology, biochemistry, biophysics, ecology, and computational biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.