Recombinant Rhodobacter sphaeroides UPF0093 membrane protein RHOS4_28450 (RHOS4_28450)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Rhodobacter sphaeroides UPF0093 membrane protein RHOS4_28450, also referred to as protein-U, is a protein that was previously uncharacterized and annotated as a hypothetical protein in the Rhodobacter sphaeroides genome . This protein is an integral membrane protein found in the light-harvesting-reaction center (LH1-RC) core complex of Rhodobacter sphaeroides .

Characteristics

  • Source: E. coli .

  • Tag: His Tagged .

  • Protein Length: Full Length (1-165 amino acids) .

  • Form: Lyophilized powder .

  • Species: Rhodobacter sphaeroides .

Creative Biomart offers the recombinant full-length Rhodobacter sphaeroides UPF0093 membrane protein RHOS4_28450, which is fused to an N-terminal His tag and expressed in E. coli .

Structure and Function

The LH1 complex in Rhodobacter sphaeroides typically forms an S-shaped structure consisting of α- and β-polypeptides, which incorporates two reaction centers (RCs), forming a dimeric LH1-RC complex . Protein-U exhibits a U-shaped conformation near the LH1-ring opening . Research indicates that the deletion of protein-U results in a significant reduction in the amount of the dimeric LH1-RC, suggesting it plays an important role in the dimerization process of the LH1-RC complex .

Protein-U interacts with the LH1 polypeptides and the RC-L subunit, potentially acting as a "spacer" to prevent the formation of a closed LH1 ring . Genomic database searches within the Rhodobacter genus have identified protein-U (or protein-U-like) genes in several species .

Role in Photosynthesis

Rhodobacter sphaeroides serves as a model organism for studying bacterial photosynthesis . The intracytoplasmic membrane (ICM) of Rhodobacter sphaeroides is essential for bacterial photosynthesis . Protein-U is not indispensable for photosynthesis, but it increases the amount of the dimeric LH1-RC .

Genetic and Evolutionary Aspects

Proteins-U are classified into three types based on their sequences :

  • Type-1: Found in Rba. johrii, Rba. megalophilus, and most Rba. sphaeroides strains.

  • Type-2: Found in Rba. ovatus.

  • Type-3: Found in Rba. azotoformans, Rba. sediminicola, and Rba. sphaeroides ATCC 17025.

Type-1 and Type-3 proteins-U have similar numbers of residues and high sequence identity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RHOS4_28450; RSP_1232; Protoporphyrinogen IX oxidase; PPO; ORF1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Target Names
RHOS4_28450
Target Protein Sequence
MRMADHFEETTMGTFLADYYLWTKSLHVISVLAWMAGLFYLPRLFVYHAEVVKAGTETDA LFQTMERRLLRAIMNPAMIATWIFGLLLVFTPGIVDWSMLWPWTKAACVLAMTGFHMWLA ARRRDFAAGANRHKGRTYRMMNELPTLLMLVIVFSAVAKWNYWGF
Uniprot No.

Target Background

Function

This recombinant Rhodobacter sphaeroides UPF0093 membrane protein (RHOS4_28450) catalyzes the oxidation of protoporphyrinogen IX to protoporphyrin IX. It plays a crucial role in the biosynthesis of tetrapyrrole molecules, including heme and chlorophyll. Importantly, this enzyme does not utilize oxygen or artificial electron acceptors such as menadione or benzoquinone.

Database Links
Protein Families
UPF0093 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the known synonyms and database identifiers for RHOS4_28450?

To ensure comprehensive literature searches and database cross-referencing, researchers should be aware of all relevant identifiers:

Database/Identifier TypeValue
Gene NameRHOS4_28450
SynonymsRSP_1232, Protoporphyrinogen IX oxidase, PPO, ORF1
UniProt IDQ53229

When conducting literature searches or database queries, using multiple identifiers is recommended to capture all relevant information, as some publications may use alternative nomenclature . The association with protoporphyrinogen IX oxidase function suggests potential involvement in tetrapyrrole metabolism, which is critical for photosynthetic and respiratory processes.

How should recombinant RHOS4_28450 protein be reconstituted for experimental use?

For optimal reconstitution of lyophilized recombinant RHOS4_28450:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (50% is standard) for long-term storage stability.

  • Aliquot to avoid repeated freeze-thaw cycles, which significantly reduce protein activity.

  • Store working aliquots at 4°C for up to one week.

  • Maintain long-term storage at -20°C/-80°C .

This methodological approach preserves protein integrity and maintains functional activity for experimental applications. The addition of glycerol is critical as it prevents ice crystal formation that can disrupt protein structure during freeze-thaw cycles.

What expression systems are most effective for producing functional recombinant RHOS4_28450?

While E. coli is the reported expression system for commercially available RHOS4_28450 , researchers should consider several factors when designing their expression strategy:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, rapid growth, economicalMay form inclusion bodies, lacks post-translational modificationsUse specialized strains (C41/C43), lower induction temperature (16-25°C), co-express chaperones
Yeast (P. pastoris)Eukaryotic processing, high density cultureLonger expression timeOptimize codon usage, use inducible promoters
Insect cellsBetter membrane protein foldingComplex methodology, expensiveUse optimized vectors (pFastBac), monitor expression kinetics

For membrane proteins like RHOS4_28450, E. coli remains a first-choice system, but expression conditions must be carefully optimized to achieve proper folding. The His-tag placement (N-terminal in the commercial product) affects purification efficiency and potentially protein function and should be considered in construct design .

What purification strategies yield the highest purity and activity for RHOS4_28450?

A multi-step purification approach is recommended for obtaining research-grade RHOS4_28450:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  • Intermediate purification: Ion exchange chromatography to separate charged contaminants

  • Polishing step: Size exclusion chromatography for final purity assessment

Critical considerations include:

  • Detergent selection is crucial for membrane protein extraction and stability (consider n-dodecyl-β-D-maltoside or CHAPS)

  • Buffer composition should maintain protein stability (pH 8.0 Tris/PBS-based buffers with 6% trehalose have proven effective)

  • Monitor protein purity via SDS-PAGE (target >90% purity)

  • Assess functional activity through appropriate biochemical assays

The presence of trehalose in storage buffers serves as a protein stabilizer, maintaining structural integrity during freeze-thaw cycles and lyophilization processes.

How should experimental controls be designed when studying RHOS4_28450 function?

Robust experimental design requires appropriate controls:

  • Negative controls:

    • Empty vector-transformed cells to account for host cell protein effects

    • Heat-denatured RHOS4_28450 to establish baseline in activity assays

    • Buffer-only controls for binding studies

  • Positive controls:

    • Related characterized membrane proteins from Rhodobacter sphaeroides

    • Well-characterized UPF0093 family proteins from other species

  • Experimental validation approaches:

    • Complementation studies in knockout strains

    • Site-directed mutagenesis of predicted functional residues

    • Comparative analysis with protein-U or other newly identified membrane proteins in Rhodobacter sphaeroides

The experimental design should follow established principles including randomization, replication, and blocking to minimize systematic errors . When studying membrane proteins, considerations for the lipid environment are particularly important for maintaining native conformation and function.

How does RHOS4_28450 contribute to photosynthetic function in Rhodobacter sphaeroides?

The potential role of RHOS4_28450 in photosynthesis should be investigated through comparative analysis with other photosynthetic complexes:

The light-harvesting-reaction center (LH1-RC) core complex of Rhodobacter sphaeroides contains multiple protein components, including the recently identified protein-U . While direct evidence linking RHOS4_28450 to photosynthesis is not established in the search results, its annotation as a potential protoporphyrinogen IX oxidase suggests involvement in tetrapyrrole metabolism critical for photosynthesis .

Research approaches to investigate this connection include:

  • Co-localization studies with photosynthetic complexes

  • Knockout/knockdown phenotype analysis focusing on photosynthetic efficiency

  • Interaction studies with known photosynthetic proteins, particularly protein-U or PufX

  • Comparative metabolomic analysis of tetrapyrrole intermediates in wild-type versus RHOS4_28450-modified strains

Current research on Rhodobacter sphaeroides has revealed that integral membrane proteins play crucial structural roles in photosynthetic complexes, as demonstrated by the discovery that protein-U contributes to dimerization of the LH1-RC complex .

What structural characterization techniques are most informative for RHOS4_28450?

Multiple complementary approaches are recommended for comprehensive structural analysis:

TechniqueResolutionInformation ObtainedConsiderations
Cryo-EM2-4 Å3D structure, protein-lipid interactionsRequires high sample purity, homogeneity
X-ray Crystallography1.5-3 ÅAtomic resolution structureChallenging for membrane proteins, requires crystallization
NMR SpectroscopyVariableDynamic information, ligand bindingSize limitations, requires isotope labeling
Circular DichroismLowSecondary structure contentQuick assessment of folding, thermal stability
Computational ModelingTheoreticalStructure prediction, functional sitesRequires experimental validation

Recent advances in cryo-EM have revolutionized membrane protein structural biology, as demonstrated by the successful determination of the Rhodobacter sphaeroides LH1-RC complex structure at 2.9 Å resolution . This approach could be particularly valuable for RHOS4_28450 characterization.

For functional domains identification, combining in silico prediction tools with targeted mutagenesis and activity assays provides a powerful approach to structure-function relationships.

How can protein-protein interactions of RHOS4_28450 be identified and validated?

A multi-tiered experimental strategy is recommended:

  • Discovery phase techniques:

    • Co-immunoprecipitation with anti-His tag antibodies

    • Bacterial two-hybrid screening

    • Proximity labeling approaches (BioID or APEX2)

    • Chemical cross-linking coupled with mass spectrometry

  • Validation approaches:

    • Fluorescence resonance energy transfer (FRET)

    • Surface plasmon resonance (SPR) for quantitative binding parameters

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization

    • Native PAGE analysis of purified complexes

  • Functional relevance assessment:

    • Co-expression/co-deletion phenotypic analysis

    • Domain mapping of interaction interfaces

    • Competition assays with predicted binding partners

Particular attention should be paid to potential interactions with other membrane components identified in Rhodobacter sphaeroides, such as PufX and protein-U, which play important roles in the assembly and function of photosynthetic complexes .

How should researchers address expression and solubility challenges with RHOS4_28450?

Membrane proteins present unique challenges in recombinant expression systems. Consider these targeted approaches:

  • Expression optimization:

    • Reduce induction temperature to 16-20°C to slow expression and improve folding

    • Test multiple E. coli strains (BL21, C41/C43, Rosetta) for optimal expression

    • Evaluate different induction conditions (IPTG concentration, induction time)

    • Consider autoinduction media for gradual protein production

  • Solubility enhancement:

    • Screen detergent panel (non-ionic, zwitterionic, and mild ionic detergents)

    • Test detergent-lipid mixtures to mimic native membrane environment

    • Evaluate fusion tags beyond His-tag (MBP, SUMO, Trx) that can enhance solubility

    • Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) for native-like environments

  • Troubleshooting approaches:

    • Western blot analysis to verify expression when visible bands are absent

    • Mass spectrometry to confirm protein identity and potential modifications

    • Functional assays in membrane fractions if purified protein proves challenging

When analyzing protein purity by SDS-PAGE, a purity level greater than 90% should be targeted for most functional and structural studies .

How can researchers differentiate the functions of RHOS4_28450 from other membrane proteins in Rhodobacter sphaeroides?

Distinguishing the specific functions requires systematic approaches:

  • Genetic manipulation strategies:

    • Generate precise knockout mutants using CRISPR-Cas9 or homologous recombination

    • Create conditional expression systems to control protein levels

    • Develop fluorescent protein fusions for localization studies that don't impair function

  • Comparative functional analysis:

    • Conduct phenotypic profiling under different growth conditions

    • Perform comparative transcriptomics/proteomics between wild-type and mutant strains

    • Analyze growth and photosynthetic efficiency parameters

  • Evolutionary perspectives:

    • Conduct phylogenetic analysis of UPF0093 family proteins

    • Compare with homologs in non-photosynthetic bacteria

    • Assess conservation patterns to identify functionally important residues

Research on the dimeric LH1-RC complex has shown that specific membrane proteins like protein-U play critical roles in complex assembly and function . Similar experimental approaches could elucidate RHOS4_28450's specific contributions to cellular processes.

What are the best practices for analyzing contradictory experimental results regarding RHOS4_28450?

When facing contradictory results:

  • Systematic reevaluation:

    • Verify protein identity and integrity by mass spectrometry

    • Assess batch-to-batch variation in protein preparations

    • Evaluate buffer and experimental condition differences between contradictory results

  • Methodological triangulation:

    • Apply multiple independent techniques to address the same question

    • Involve different research teams to replicate critical experiments

    • Consider environmental variables (temperature, pH, ionic strength) that might explain discrepancies

  • Statistical and experimental design considerations:

    • Ensure adequate statistical power in experimental design

    • Apply appropriate statistical tests for data analysis

    • Consider factorial experimental designs to identify interaction effects between variables

  • Integration of contradictory findings:

    • Develop testable hypotheses that could explain apparent contradictions

    • Consider context-dependent protein functions (different growth conditions, interactions)

    • Evaluate potential post-translational modifications or alternate isoforms

The principles of experimental design, including randomization, replication, and blocking, are essential for generating reliable data that can resolve contradictions .

How might RHOS4_28450 function compare to newly identified membrane proteins in Rhodobacter sphaeroides?

The discovery of protein-U in Rhodobacter sphaeroides provides an important comparative framework:

Protein-U was found to have a U-shaped conformation near the LH1-ring opening in the photosynthetic complex and plays an important role in dimerization of the LH1-RC complex . This suggests that apparently minor membrane proteins can have crucial structural and functional roles in complex assemblies.

Future research directions include:

  • Comparative structural analysis between RHOS4_28450 and protein-U

  • Investigation of potential interactions between these proteins

  • Evaluation of evolutionary relationships and potential functional redundancy

  • Assessment of their respective roles in photosynthetic efficiency and bacterial metabolism

The positioning of protein components within membrane complexes, as revealed by cryo-EM studies, can provide critical insights into their functional roles and interactions. The high-resolution structural determination methods that successfully characterized protein-U could be applied to RHOS4_28450 .

What methodological innovations might enhance RHOS4_28450 research?

Emerging technologies offer new opportunities for RHOS4_28450 investigation:

  • Advanced structural biology approaches:

    • Time-resolved cryo-EM for conformational dynamics

    • Integrative structural biology combining multiple data sources

    • MicroED for structure determination from nanocrystals

  • Functional genomics tools:

    • CRISPRi for tunable gene expression modulation

    • Multiplex genome editing to assess genetic interactions

    • Single-cell transcriptomics to assess heterogeneity in bacterial populations

  • Biophysical characterization:

    • Single-molecule FRET for conformational dynamics

    • Native mass spectrometry for intact membrane protein complexes

    • High-speed atomic force microscopy for topographical analysis

  • Computational approaches:

    • Machine learning for function prediction from sequence

    • Molecular dynamics simulations in membrane environments

    • Systems biology modeling of photosynthetic networks

These methodological innovations would complement traditional biochemical and genetic approaches to provide a more comprehensive understanding of RHOS4_28450 function in cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.