Recombinant Rhodococcus erythropolis NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase and what role does the nuoK subunit play?

NADH-quinone oxidoreductase (NDH-1) is a prokaryotic proton-translocating enzyme with an L-shaped structure consisting of 14 subunits (NuoA-NuoN). The enzyme contains two major domains: the peripheral arm (including NuoB, NuoC, NuoD, NuoE, NuoF, NuoG, and NuoI) and the membrane arm (including NuoA, NuoH, NuoJ, NuoK, NuoL, NuoM, and NuoN) . The nuoK subunit is part of the membrane arm and plays a critical role in the enzyme's proton translocation function. In Rhodococcus erythropolis, this subunit shares structural similarities with other bacterial NDH-1 complexes, though with species-specific adaptations that may reflect the organism's widespread environmental adaptability .

How does Rhodococcus erythropolis differ from other bacterial species in terms of NADH-quinone oxidoreductase structure?

Rhodococcus erythropolis possesses unique cellular characteristics that potentially influence its NADH-quinone oxidoreductase structure and function. As an aerobic Gram-positive bacterium with an unusual cell envelope composition characterized by high mycolic acid content, R. erythropolis has enhanced cell surface hydrophobicity . This characteristic likely affects membrane protein insertion and stability, including that of the membrane-bound nuoK subunit. While the core structure of NADH-quinone oxidoreductase remains conserved across species, R. erythropolis' environmental adaptability from sea level to Alpine soils and from Arctic to Antarctic environments suggests potential structural modifications that optimize enzyme function across diverse conditions .

What is the amino acid sequence and predicted structure of Rhodococcus erythropolis nuoK?

Based on homologous proteins, the Rhodococcus erythropolis nuoK subunit likely consists of approximately 100-105 amino acids. Similar to the Sorangium cellulosum nuoK protein, it likely has a transmembrane structure composed primarily of hydrophobic amino acids . While the exact sequence for R. erythropolis nuoK is not provided in the search results, comparable proteins like the S. cellulosum nuoK have sequences such as "MISVPIEYYLVVAAVLFLIGSIGFLLRRNLLVLLMSIELMLNAVNLTLVAYNRVHPHDHA GQIFTFFVIAIAAAEAAVGLAIVLAFYRIRKTMRSDDADLLRS" . Structural predictions would suggest multiple transmembrane helices that anchor the protein within the bacterial membrane, consistent with its role in the membrane arm of the NDH-1 complex.

What expression systems are most effective for producing recombinant Rhodococcus erythropolis nuoK protein?

For recombinant expression of membrane proteins like nuoK from Rhodococcus erythropolis, Escherichia coli expression systems are commonly employed due to their high yield and ease of genetic manipulation. Based on similar protein expression approaches, the most effective strategy involves expressing the protein with an N-terminal His-tag in E. coli using vectors with strong, inducible promoters such as T7 . For membrane proteins like nuoK, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may provide better results by accommodating the potential toxicity of overexpressed membrane proteins. Expression conditions typically require optimization of induction temperature (often lowered to 18-25°C), inducer concentration, and expression duration to maximize functional protein yield.

What purification strategy yields the highest purity of recombinant Rhodococcus erythropolis nuoK?

The optimal purification strategy for recombinant R. erythropolis nuoK would follow similar approaches used for homologous proteins:

• Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

• Size exclusion chromatography to separate aggregates and improve homogeneity

• Optional ion exchange chromatography for removing remaining contaminants

For membrane proteins like nuoK, detergent selection is critical during solubilization and purification. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-decyl-β-D-maltoside (DM) are frequently effective. The purification buffer should contain stabilizing agents such as glycerol (5-10%) and potentially specific lipids to maintain protein stability. Final purity should exceed 90% as determined by SDS-PAGE analysis . Storage conditions should include flash-freezing aliquots with 6% trehalose or similar cryoprotectants in a Tris/PBS-based buffer at pH 8.0 and maintaining at -80°C to prevent freeze-thaw degradation .

How can researchers optimize solubilization of recombinant Rhodococcus erythropolis nuoK while maintaining its functional integrity?

Optimizing solubilization of the nuoK membrane protein requires careful consideration of detergent selection and solubilization conditions:

• Detergent screening: Test a panel of detergents including DDM, DM, LMNG, and Digitonin at various concentrations (typically 0.5-2% for initial extraction)

• Buffer optimization: Test various pH conditions (typically pH 7.0-8.5) and ionic strengths

• Solubilization duration and temperature: Compare short (1-2 hours) versus extended (overnight) solubilization periods at both 4°C and room temperature

• Protective additives: Include glycerol (5-20%), reducing agents (DTT or TCEP at 1-5 mM), and protease inhibitors

Functional integrity can be assessed through activity assays following reconstitution into proteoliposomes or nanodiscs, or through binding assays with known interaction partners. The membrane environment of R. erythropolis, with its unique mycolic acid content and adaptation to various ecological niches, may require specialized solubilization conditions that differ from those used for other bacterial membrane proteins .

What assays can be used to measure the enzymatic activity of recombinant Rhodococcus erythropolis nuoK?

• Reconstitution assays: Incorporate purified nuoK into proteoliposomes or nanodiscs with other NDH-1 subunits to measure reconstituted activity

• NADH oxidation assays: When incorporated into the complete complex, measure NADH oxidation rates using spectrophotometric methods at 340 nm

• dNADH-specific assays: Use deamino-NADH (dNADH) as substrate, which is specific to NDH-1 and not oxidized by alternative NADH dehydrogenases like NDH-2

• Electron transfer measurements: Assess electron transfer from NADH to artificial electron acceptors like potassium ferricyanide (K₃Fe(CN)₆)

• Proton translocation assays: Measure pH changes or use pH-sensitive fluorescent dyes in reconstituted systems

For comparative analysis, the data from Table 1 in the literature shows how different mutations affect NDH-1 activities, which could be adapted for nuoK functional studies:

What structural features are essential for nuoK integration into the complete NADH-quinone oxidoreductase complex?

Based on studies of homologous proteins, several structural features are critical for proper nuoK integration into the NDH-1 complex:

• Transmembrane helices: The hydrophobic transmembrane segments must be correctly positioned for membrane insertion and interaction with adjacent subunits

• Conserved charged residues: Similar to the pivotal roles of conserved carboxyl residues (Glu-138, Glu-140, and Asp-143) identified in the NuoC subunit , nuoK likely contains essential charged residues that facilitate subunit interactions or functional activities

• Interface regions: Specific amino acid sequences at subunit interfaces are crucial for proper assembly

Research with E. coli NDH-1 has demonstrated that mutations in conserved residues can dramatically impact both assembly and activity of the complex. For example, the E138A mutation in NuoC reduced activity to ~2-3% of wild type levels . Similar experimental approaches could be applied to nuoK, with complementation studies in knockout strains being particularly informative.

Assembly can be assessed using blue native PAGE analysis, which can reveal whether specific mutations affect the formation of subcomplexes or the complete NDH-1 assembly, similar to the approaches used in the study of NuoC mutations .

How does the nuoK subunit from Rhodococcus erythropolis compare to homologous subunits in other bacterial species?

Comparative analysis would likely reveal:

• Core conservation: Transmembrane topology and key functional residues would be conserved across species

• Variable regions: Surface-exposed loops may show higher variability

• Thermal adaptations: Species adapted to extreme temperatures (like R. erythropolis strains from Arctic/Antarctic environments) may show amino acid compositions favoring stability at their respective temperature ranges

A detailed homology analysis comparing nuoK sequences from R. erythropolis with those from other bacterial species, particularly those from different environmental niches, would provide valuable insights into structure-function relationships and evolutionary adaptations.

What evolutionary insights can be gained from studying Rhodococcus erythropolis nuoK in comparison to other respiratory chain components?

The study of R. erythropolis nuoK in the context of respiratory chain evolution offers several important insights:

• Respiratory chain adaptation: As R. erythropolis inhabits diverse environments from deep sea to Alpine soils and from Arctic to Antarctic regions , its respiratory components, including nuoK, may exhibit specific adaptations that maintain functionality across varying oxygen concentrations, temperatures, and pressures

• Evolutionary conservation: Comparing the sequence conservation patterns of nuoK to other respiratory complex subunits can reveal which protein regions are under stronger evolutionary pressure

• Lateral gene transfer: Analysis of codon usage and phylogenetic comparisons may reveal instances of lateral gene transfer in respiratory chain components

The environmental versatility of R. erythropolis suggests that its respiratory chain, including the NADH-quinone oxidoreductase complex, has evolved remarkable adaptability. This adaptability is likely reflected in specific amino acid substitutions that maintain protein stability and function across diverse conditions, making comparative analysis particularly valuable for understanding protein evolution in response to environmental challenges.

How can site-directed mutagenesis of Rhodococcus erythropolis nuoK inform our understanding of proton translocation mechanisms?

Site-directed mutagenesis of R. erythropolis nuoK can provide critical insights into proton translocation mechanisms through systematic modification of key residues. Based on research with other NADH-quinone oxidoreductase subunits, a methodological approach would include:

• Targeting conserved charged residues: Focus on glutamate, aspartate, lysine, and histidine residues within transmembrane regions, similar to the pivotal Glu-138, Glu-140, and Asp-143 residues identified in NuoC

• Conservative vs. non-conservative substitutions: Compare effects of maintaining charge (e.g., Glu→Asp) versus eliminating it (Glu→Ala), as demonstrated in the E140D mutation that retained 85-104% activity versus E140A that showed only 5-7% activity

• Functional assays: Employ multiple assay types (dNADH oxidase, dNADH-quinone oxidoreductase, dNADH-ferricyanide reductase) to comprehensively evaluate the impact of mutations, as shown in Table 1 from the literature :

This approach would allow researchers to identify residues essential for proton translocation, distinguish between structural and functional roles, and potentially map the proton pathway through the membrane domain of the complex.

What are the challenges in crystallizing membrane proteins like Rhodococcus erythropolis nuoK, and what alternative structural determination methods can be employed?

Crystallizing membrane proteins like R. erythropolis nuoK presents several significant challenges:

• Detergent selection: Finding detergents that efficiently extract the protein while maintaining its native conformation

• Protein stability: Maintaining stability during purification and crystallization attempts

• Crystal contacts: Limited hydrophilic surfaces for crystal contacts due to the transmembrane nature

• Conformational heterogeneity: Multiple conformational states that hinder crystal formation

Alternative structural determination methods include:

• Cryo-electron microscopy (cryo-EM): Particularly suitable for membrane proteins and large complexes, avoiding crystallization requirements

• Nuclear magnetic resonance (NMR): Useful for smaller membrane proteins or domains in detergent micelles or nanodiscs

• Cross-linking mass spectrometry (XL-MS): Provides distance constraints between amino acids to inform structural models

• Molecular dynamics simulations: Combined with limited experimental data to predict structure and dynamics

• AlphaFold2 and similar AI-based prediction tools: Increasingly accurate for transmembrane protein prediction

For R. erythropolis nuoK specifically, its relatively small size (~100-103 amino acids based on homologous proteins ) makes it potentially amenable to solution NMR studies when incorporated into nanodiscs or detergent micelles. Alternatively, studying it within the context of the entire NDH-1 complex using cryo-EM could provide valuable structural insights in a more native-like environment.

How might the unique environmental adaptability of Rhodococcus erythropolis influence the structure-function relationship of its nuoK subunit?

The remarkable environmental adaptability of R. erythropolis, which has been isolated from diverse ecosystems ranging from sea level to Alpine soils, deep sea to coastal sediments, and Arctic to Antarctic samples , suggests specialized adaptations in its membrane proteins, including nuoK.

Potential structure-function adaptations might include:

• Temperature adaptations: Amino acid compositions that maintain proper folding and flexibility across temperature ranges, potentially with different patterns in psychrophilic versus mesophilic strains

• Pressure adaptations: Structural features that resist compression in deep-sea isolates

• Lipid interactions: Specialized interactions with the unusual cell envelope composition high in mycolic acids, which helps the bacterium survive between polar and non-polar media

• Proton gradient maintenance: Adaptations for maintaining proton motive force under varying environmental conditions

Research approaches to investigate these adaptations could include:

• Comparative genomics of R. erythropolis strains from different environments

• Expression and functional characterization of nuoK from strains adapted to different conditions

• Molecular dynamics simulations under varying temperature and pressure conditions

• Lipidomic analysis combined with protein-lipid interaction studies

What strategies can overcome low expression yields of recombinant Rhodococcus erythropolis nuoK in E. coli systems?

Low expression yields of membrane proteins like nuoK are common challenges. Several strategies can address this issue:

• Codon optimization: Adapt the R. erythropolis nuoK coding sequence to E. coli codon usage bias

• Expression strain selection: Test specialized strains such as C41(DE3), C43(DE3), or Lemo21(DE3) designed for membrane protein expression

• Fusion tags: Beyond His-tags, consider fusion partners like MBP (maltose-binding protein) or SUMO that can enhance solubility and expression

• Expression conditions optimization:

  • Reduce growth temperature (18-25°C)

  • Lower inducer concentration (0.1-0.2 mM IPTG)

  • Extend expression time (overnight)

  • Test auto-induction media

• Chaperone co-expression: Co-express molecular chaperones (GroEL/ES, DnaK/J) to aid proper folding

• Alternative expression hosts: Consider Rhodococcus species as expression hosts for homologous expression

When optimizing reconstitution protocols for expressed nuoK, researchers should consider including specific lipids, particularly those enriched in mycolic acids that mimic the native R. erythropolis membrane environment , which may significantly improve protein stability and functional recovery.

How can researchers distinguish between assembly defects and catalytic defects when studying nuoK mutations?

Distinguishing between assembly and catalytic defects is crucial for interpreting mutation effects. Based on approaches used for studying other NDH-1 components, researchers should employ a multi-faceted strategy:

• Blue native PAGE analysis: Assess whether the complete NDH-1 complex forms or whether subcomplexes accumulate, similar to the approach used for NuoC mutants

• Immunoblotting: Use antibodies against multiple NDH-1 subunits to determine if specific mutations affect stability of particular components

• Activity measurements at different levels:

  • NADH dehydrogenase activity (dNADH-K₃Fe(CN)₆) to assess electron input function

  • Complete NADH oxidase activity to assess full electron transfer pathway

  • dNADH-quinone oxidoreductase activity to assess specific segments of electron transfer

• Thermal stability assays: Differential scanning fluorimetry to assess protein stability independent of activity

• Complementation studies: Express wild-type or mutant nuoK in knockout strains to assess rescue of function

From research on other NDH-1 subunits, mutations that primarily affect assembly typically show consistent reduction across all activity measurements, while catalytic defects may show differential effects on various activities. For example, the D143E mutation in NuoC maintained or enhanced all activities (103-132% of wild type), while E138A severely reduced functional activities (2-3% of wild type) despite retaining 49% of dehydrogenase activity, suggesting primarily a catalytic rather than structural role .

What approaches can be used to investigate potential interactions between Rhodococcus erythropolis nuoK and other subunits of the NADH-quinone oxidoreductase complex?

Investigating subunit interactions involving nuoK requires specialized approaches due to its membrane-embedded nature:

• Cross-linking coupled with mass spectrometry (XL-MS):

  • Use membrane-permeable cross-linkers at varying concentrations

  • Identify cross-linked peptides to map interaction surfaces

  • Compare cross-linking patterns between wild-type and mutant proteins

• Co-immunoprecipitation with tagged subunits:

  • Express epitope-tagged versions of nuoK and potential interaction partners

  • Perform pull-down experiments under varying detergent conditions

  • Identify co-precipitating proteins by immunoblotting or mass spectrometry

• Genetic suppressor analysis:

  • Identify second-site suppressors that restore function in nuoK mutants

  • Map these suppressors to potential interaction partners

• FRET or BRET assays:

  • Generate fluorescent protein fusions

  • Measure energy transfer as an indicator of proximity

• Split reporter assays:

  • Fuse fragments of reporters (GFP, luciferase) to nuoK and potential partners

  • Reconstitution of activity indicates interaction

Based on research with other NDH-1 subunits, conserved charged residues often play dual roles in catalysis and subunit interactions. For instance, the critical residues Glu-138, Glu-140, and Asp-143 in NuoC were found to be "absolutely required for the energy-transducing NDH-1 activities and the assembly of the whole enzyme" , suggesting their involvement in inter-subunit interactions.

What emerging technologies might advance our understanding of Rhodococcus erythropolis nuoK structure and function?

Several cutting-edge technologies hold promise for advancing research on R. erythropolis nuoK:

• Cryo-electron tomography: For visualizing the NDH-1 complex in its native membrane environment

• AlphaFold2 and RoseTTAFold: AI-based structure prediction tools showing remarkable accuracy for membrane proteins

• Single-molecule FRET: For examining conformational changes during enzyme function

• Nanodiscs and styrene-maleic acid lipid particles (SMALPs): For studying membrane proteins in more native-like lipid environments

• Time-resolved serial crystallography: For capturing dynamic states of the enzyme complex

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): For probing protein dynamics and solvent accessibility

• Microfluidic approaches: For high-throughput screening of conditions affecting stability and function

These technologies could provide unprecedented insights into nuoK's role within the respiratory complex and its adaptations to R. erythropolis' diverse ecological niches .

How might understanding Rhodococcus erythropolis nuoK contribute to biotechnological applications?

R. erythropolis is known for its remarkable metabolic versatility and environmental adaptability , making it a valuable organism for biotechnological applications. Understanding nuoK could contribute to several applications:

• Bioremediation enhancement: Optimizing energy generation in engineered R. erythropolis strains for improved performance in pollutant degradation

• Biocatalysis: Engineering respiratory chains for improved redox balance during biotransformation reactions

• Biosensor development: Using components of the respiratory chain as electron acceptors in whole-cell biosensors

• Protein engineering: Applying insights from R. erythropolis' adaptation to extreme environments to engineer stability in other membrane proteins

• Synthetic biology: Incorporating robust respiratory components from R. erythropolis into synthetic microbial chassis

The environmental resilience of R. erythropolis respiratory components, adapted to function across diverse ecological niches , makes them particularly valuable for applications requiring stability under challenging conditions.

What computational approaches could enhance prediction of structure-function relationships in Rhodococcus erythropolis nuoK?

Advanced computational approaches offer powerful tools for predicting structure-function relationships in nuoK:

• Molecular dynamics simulations:

  • All-atom simulations in explicit membrane environments

  • Coarse-grained simulations for longer timescales

  • Enhanced sampling methods to explore conformational space

• Quantum mechanics/molecular mechanics (QM/MM) calculations:

  • For modeling electron transfer and proton translocation

  • Particularly valuable for examining conserved charged residues

• Network analysis:

  • Identify residue interaction networks and evolutionary couplings

  • Predict allosteric communication pathways

• Integrative modeling:

  • Combine limited experimental data (cross-linking, HDX-MS, etc.) with computational predictions

  • Iterative refinement of models based on experimental validation

• Machine learning approaches:

  • Predict the impact of mutations on stability and function

  • Identify patterns in sequence-structure-function relationships

These computational approaches, when combined with targeted experimental validation, could significantly accelerate our understanding of how the unique environmental adaptability of R. erythropolis is reflected in the structure and function of its respiratory components, including nuoK.

How should researchers design experiments to compare nuoK function across different Rhodococcus erythropolis strains from diverse environments?

Given R. erythropolis' remarkable distribution across diverse environments from sea level to Alpine soils and polar regions , comparing nuoK across strains provides valuable insights into environmental adaptation. An optimal experimental design would include:

• Strain selection:

  • Arctic/Antarctic isolates (psychrophilic)

  • Temperate soil isolates (mesophilic)

  • Deep-sea isolates (barophilic)

  • Pollutant-exposed isolates (potentially stress-adapted)

• Genomic analysis:

  • Sequence nuoK and surrounding genes

  • Identify amino acid variations correlating with environmental origin

  • Analyze selection pressure using dN/dS ratios

• Heterologous expression:

  • Express nuoK variants in a common host (E. coli knockout strain)

  • Use identical tags and expression systems for fair comparison

  • Evaluate expression, stability, and activity under standardized conditions

• Functional characterization under various conditions:

  • Temperature range (5-45°C)

  • Pressure range (1-500 atm for deep-sea comparisons)

  • pH range (5.0-9.0)

  • Various lipid environments

• Structural characterization:

  • Circular dichroism to assess secondary structure stability

  • Thermal denaturation profiles

  • Limited proteolysis for conformational assessment

This comprehensive approach would reveal how nuoK has adapted to function across R. erythropolis' diverse ecological niches and might identify key residues involved in environmental adaptation.

What controls are essential when performing site-directed mutagenesis studies on Rhodococcus erythropolis nuoK?

Site-directed mutagenesis studies require rigorous controls to ensure valid interpretations:

• Genetic controls:

  • Wild-type complementation (essential to verify the genetic manipulation system)

  • Empty vector control

  • Synonymous mutations (changing codons without changing amino acids) to control for nucleic acid structure effects

• Mutation design controls:

  • Conservative mutations (e.g., Glu→Asp) versus non-conservative (Glu→Ala)

  • Surface residue mutations as negative controls

  • Known functional residue mutations as positive controls

• Experimental verification controls:

  • Sequence verification of the entire gene, not just the mutation site

  • Expression level verification (Western blot)

  • Proper membrane insertion verification (fractionation studies)

• Functional assessment controls:

  • Multiple activity assays (as shown in Table 1 from similar studies )

  • Temperature dependence as internal control

  • Substrate concentration series

The importance of proper controls is highlighted by studies of other NDH-1 subunits, where conservative mutations like E140D maintained 85-104% activity while non-conservative mutations of the same residue (E140A) reduced activity to 5-7% . Similarly, reintroduction of the native sequence into knockout strains (KO-C-rev) showed complete restoration of function, confirming the validity of the genetic manipulation approach .

How can researchers address the challenge of studying a single subunit (nuoK) that functions as part of a multi-subunit complex?

Studying nuoK in isolation presents challenges since it naturally functions within the larger NDH-1 complex. Several approaches can address this:

• Knockout-complementation systems:

  • Generate a nuoK knockout strain

  • Complement with wild-type or mutant nuoK

  • Assess whole-complex assembly and function

  • This approach was successfully used for studying NuoC, where the KO-C strain showed only 1-3% of wild-type oxidase activity

• Subcomplexes reconstitution:

  • Express and purify multiple interacting subunits

  • Reconstitute functional subcomplexes

  • Study nuoK in this simplified context

• Chimeric approaches:

  • Create chimeric proteins between R. erythropolis nuoK and homologs from well-studied species

  • Map functional regions by domain swapping

• Co-expression strategies:

  • Co-express nuoK with its immediate interaction partners

  • Purify the resulting subcomplex

  • Perform structural and functional studies

• In situ approaches:

  • Study nuoK within native membranes using techniques like solid-state NMR

  • Use chemical probes for accessibility studies in the native complex