Recombinant Rhodococcus opacus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Genetic Attributes

  • Gene Name: nuoK

  • Synonyms: NADH dehydrogenase I subunit K, NDH-1 subunit K

  • UniProt ID: C1AZF7 (strain B4) , A1ADC7 (partial protein in E. coli)

  • Locus: ROP_59810 (strain B4)

Amino Acid Sequence

PositionSequence
1–20MNPENYLYLSALLFTIGAAGVLIRRNAIIVFMCIELMLNASNLAFVTFARMHGNLDGQVF AFFTMVVAAAEVVVGLAIIMTIFRSRRSASVDDANLLKN
Key MotifsIncludes transmembrane domains and conserved regions critical for NDH-1 assembly

Expression and Production

Recombinant nuoK is produced via heterologous expression in Escherichia coli or Baculovirus systems . Key features include:

  • Host System: E. coli (primary) or Baculovirus (partial protein)

  • Expression Region: Full-length (1–99 aa) , partial (varies by construct)

  • Yield: Commercially available in quantities up to 50 µg , with scalability for bulk orders.

Experimental Uses

  • Enzymatic Studies: Structural and functional characterization of NDH-1 complexes .

  • ELISA Assays: Detection and quantification of nuoK in R. opacus strains .

  • Biocatalysis: Potential utility in biofuel production or pollutant remediation, leveraging Rhodococcus’ metabolic versatility .

Handling and Stability Recommendations

ParameterGuideline
StorageLyophilized: -20°C/-80°C; Liquid: -20°C (6 months)
ReconstitutionUse sterile water, avoid repeated freeze-thaw cycles
StabilityWorking aliquots stable at 4°C for ≤1 week
Buffer AdditivesGlycerol (5–50%) recommended for long-term preservation

Metabolic Integration

While nuoK-specific studies are sparse, transcriptomic analyses of R. opacus R7 highlight the importance of NDH-1 in balancing redox states during hydrocarbon degradation . For example:

  • Upregulated NDH-1: Observed during o-xylene metabolism, suggesting a role in managing oxidative stress .

  • Genome-Scale Models: R. opacus PD630’s NDH-1 is modeled in iGR1773, a genome-scale metabolic model, to predict flux distributions under aromatic substrate utilization .

Challenges and Opportunities

  • Low Recombination Efficiency: R. opacus’ mycolic acid-rich cell wall complicates genetic engineering, necessitating optimized vectors .

  • Biotechnological Potential: Engineered nuoK variants could enhance electron transport efficiency in bioelectrochemical systems or biofuel production .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please include this information in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; ROP_59810; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Rhodococcus opacus (strain B4)
Target Names
nuoK
Target Protein Sequence
MNPENYLYLSALLFTIGAAGVLIRRNAIIVFMCIELMLNASNLAFVTFARMHGNLDGQVF AFFTMVVAAAEVVVGLAIIMTIFRSRRSASVDDANLLKN
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be a menaquinone. This process couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its role in Rhodococcus opacus?

NADH-quinone oxidoreductase (Complex I) represents the entry point of electrons into the respiratory chain in most bacteria, including Rhodococcus species. The nuoK subunit serves as one of the membrane-embedded components of this complex, contributing to proton translocation across the cell membrane. In R. opacus, nuoK likely plays a critical role in energy conservation during the oxidation of various carbon sources, including aromatic compounds.

To study nuoK function, researchers typically employ comparative genomics approaches. The genome-scale model iGR1773 for R. opacus PD630 includes 1773 genes, 3025 reactions, and 1956 metabolites, providing a framework for understanding nuoK within the broader metabolic context . Methodologically, identification of nuoK can be achieved through sequence homology searches against well-characterized nuoK sequences from related organisms, followed by functional annotation based on conserved domains.

How does the expression of nuoK change under different growth conditions in R. opacus?

Transcriptomic studies indicate that oxidoreductase expression in R. opacus varies significantly depending on carbon source. When grown on aromatic compounds versus conventional sugars, R. opacus demonstrates differential expression patterns across numerous oxidoreductases .

Methodological approach:

  • Culture R. opacus in minimal media with different carbon sources (glucose, phenol, lignin derivatives)

  • Extract total RNA at mid-exponential phase

  • Perform RNA-seq analysis with appropriate controls

  • Normalize expression data and identify differentially expressed genes

  • Confirm expression changes through RT-qPCR targeting nuoK

Analysis of R. opacus transcriptomes reveals that when cells transition from glucose to aromatic carbon sources, significant metabolic rewiring occurs with changes in oxidoreductase expression profiles. For instance, during growth on phenol, R. opacus maintains high TCA cycle flux and accumulates TCA metabolites like malate, succinate, and α-ketoglutarate intracellularly .

What expression systems are recommended for producing recombinant R. opacus nuoK?

For successful expression of membrane proteins like nuoK, several heterologous systems can be employed:

Expression SystemAdvantagesChallengesRecommended Tags
E. coli BL21(DE3)Rapid growth, high yields, well-established protocolsPotential toxicity, inclusion body formationN-terminal His6
R. opacus strainsNative membrane composition, correct foldingLower yields, slower growthC-terminal strep-tag
P. pastorisPost-translational processing, high-density culturesLonger optimization timeFLAG or HA tags

Methodologically, researchers should:

  • Optimize codon usage for the selected expression host

  • Use inducible promoters with titratable expression

  • Include fusion tags for purification and detection

  • Consider membrane-targeted expression strategies

  • Test multiple detergents for protein extraction and stabilization

For E. coli-based expression, similar approaches to those used for other recombinant proteins can be adapted, such as the His-tagged system employed for the Ralstonia solanacearum NADH-quinone oxidoreductase subunit K .

How is the activity of recombinant nuoK typically measured in laboratory settings?

As nuoK functions as part of a multi-subunit complex, activity measurements typically involve:

  • Reconstitution assays: Combining purified nuoK with other complex I subunits and measuring NADH oxidation coupled to ubiquinone reduction

  • Membrane potential measurements: Using voltage-sensitive dyes to detect proton pumping activity

  • Complementation studies: Restoring activity in nuoK-deficient strains

A methodological workflow includes:

  • Purify recombinant nuoK using affinity chromatography

  • Reconstitute into liposomes with appropriate lipid composition

  • Add electron donors (NADH) and acceptors (ubiquinone analogs)

  • Monitor reaction progress spectrophotometrically (340 nm for NADH oxidation)

  • Calculate specific activity and kinetic parameters

When adapting protocols, researchers should consider that R. opacus modifies its membrane composition when exposed to aromatic compounds, potentially affecting nuoK function and stability .

What genomic resources are available for studying nuoK in R. opacus?

Additionally, transcriptomic data from R. opacus grown on different substrates offers insights into nuoK expression patterns. The RNA-seq datasets from R. opacus R7 grown on polyethylene and lignin-derived compounds can serve as valuable reference points, though these would need to be specifically analyzed for nuoK expression.

Methodologically, researchers should:

  • Obtain annotated genome sequences from public databases

  • Use bioinformatics tools to identify and analyze the nuoK gene context

  • Compare nuoK sequences across Rhodococcus species

  • Examine syntenic regions for insights into functional associations

How does nuoK interact with other subunits of the NADH-quinone oxidoreductase complex in R. opacus?

The NADH-quinone oxidoreductase (Complex I) typically contains 14 conserved subunits in bacteria, with nuoK situated within the membrane domain. Understanding these interactions requires specialized approaches:

Methodological strategy:

  • Cross-linking studies with MS analysis to identify interacting partners

  • Bacterial two-hybrid assays to confirm direct protein-protein interactions

  • Cryo-EM analysis of the entire complex to determine structural arrangements

  • Site-directed mutagenesis of conserved residues to identify critical interaction points

When studying multi-component complexes like NADH-quinone oxidoreductase, lessons can be drawn from the study of the StyA1/StyA2B system in R. opacus 1CP, which demonstrates complex formation with optimal activity at equimolar ratios of components . This suggests that stoichiometric balance of complex components is crucial for proper function, a principle likely applicable to nuoK and its partners.

What role might nuoK play in the exceptional metabolic versatility of R. opacus?

R. opacus is known for its ability to metabolize a wide range of substrates, including aromatic compounds derived from lignin. The nuoK subunit, as part of Complex I, may contribute to this versatility by:

  • Facilitating efficient energy conservation during growth on challenging carbon sources

  • Participating in redox balancing when metabolizing aromatic compounds

  • Adapting proton-pumping efficiency under different growth conditions

Methodologically, researchers can investigate this by:

  • Creating nuoK deletion or modification strains

  • Performing growth studies with various carbon sources

  • Measuring respiration rates under different conditions

  • Conducting 13C-metabolic flux analysis to track carbon flow

Studies of R. opacus metabolism show that when grown on phenol compared to glucose, the organism exhibits different metabolic flux patterns, particularly in central carbon metabolism . Using 13C-metabolic flux analysis (13C-MFA), researchers have observed that phenol metabolism enters primarily through the TCA cycle, with E-Flux2 flux predictions showing a high R2 of 0.96 . These approaches could be adapted to understand how nuoK contributes to these metabolic shifts.

How can protein engineering be applied to enhance the stability or activity of recombinant R. opacus nuoK?

Protein engineering strategies for nuoK might include:

Engineering ApproachMethodologyExpected OutcomeValidation Method
Rational designStructure-guided mutagenesis of conserved residuesEnhanced stability or activityActivity assays, thermal shift
Directed evolutionRandom mutagenesis and functional screeningNovel properties, improved expressionGrowth complementation
Domain swappingExchange domains with homologs from extremophilesTemperature/pH toleranceStability measurements
Computational designIn silico modeling and energy minimizationOptimized protein-lipid interactionsMolecular dynamics simulation

When developing these approaches, researchers should consider that R. opacus modifies its membrane lipid composition, including mycolic acids and phospholipids, as a strategy for aromatic tolerance . These modifications may influence nuoK stability and activity, suggesting that protein engineering should account for the native membrane environment.

What techniques are most effective for studying the protein-protein interactions of nuoK within the respiratory chain complex?

To investigate nuoK interactions, researchers can employ:

  • Proximity-dependent biotin labeling (BioID or TurboID)

    • Fuse biotin ligase to nuoK

    • Express in R. opacus

    • Identify biotinylated proteins by MS analysis

    • Validate key interactions with co-immunoprecipitation

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Compare exchange patterns of isolated nuoK versus assembled complex

    • Identify protected regions indicative of protein-protein interfaces

    • Map interaction sites to structural models

  • Site-specific crosslinking with unnatural amino acids

    • Incorporate photoreactive amino acids at predicted interface sites

    • Induce crosslinking with UV irradiation

    • Identify crosslinked partners by MS analysis

The StyA1/StyA2B system from R. opacus 1CP provides an instructive example, as it demonstrates how protein-protein interactions can significantly impact enzyme function. This system shows highest monooxygenase activity at an equimolar ratio of components, strongly indicating complex formation . Similar principles may apply to nuoK and its interaction partners.

How does recombinant nuoK integrate with current metabolic models of R. opacus?

The genome-scale model iGR1773 for R. opacus PD630 provides a framework for understanding how nuoK contributes to cellular metabolism . To integrate nuoK into this model, researchers should:

  • Identify all reactions involving Complex I in the model

  • Determine how nuoK-specific constraints affect these reactions

  • Use transcriptomic data to set appropriate flux constraints

  • Validate predictions with experimental measurements

Methodologically, the E-Flux2 approach has shown superior performance for R. opacus metabolic predictions compared to standard FBA and pFBA methods . Using transcriptomic data to constrain flux predictions, E-Flux2 achieved an R2 value of 0.54 for glucose metabolism and 0.96 for phenol metabolism when compared to 13C-MFA measurements . This suggests that integrating nuoK-specific expression data could improve model accuracy for respiratory chain reactions.

What role might nuoK play in the aromatic compound degradation pathways of R. opacus?

R. opacus is known for its ability to degrade various aromatic compounds, including lignin-derived molecules. The role of nuoK in these pathways may include:

  • Supporting energy conservation during aromatic catabolism

  • Participating in redox balancing when metabolizing phenolics

  • Contributing to membrane potential maintenance under stress conditions

To investigate this connection, researchers could:

  • Compare nuoK expression levels during growth on different aromatic substrates

  • Create nuoK mutants and assess their ability to grow on various aromatics

  • Measure respiratory chain activity during aromatic metabolism

  • Track redox cofactor (NAD+/NADH) ratios in wild-type versus nuoK-modified strains

Studies of R. opacus have shown that it uses a high-flux β-ketoadipate pathway for aromatic catabolism, converting aromatic compounds into acetyl-CoA and succinyl-CoA that enter the TCA cycle . This high TCA cycle flux produces large amounts of ATP and NADH, suggesting an important role for the NADH-quinone oxidoreductase complex (including nuoK) in maintaining redox balance during aromatic metabolism.

What are the challenges in crystallizing recombinant R. opacus nuoK for structural studies?

Membrane proteins like nuoK present significant challenges for structural studies:

ChallengePotential SolutionMethodology
Low expression yieldsOptimize expression systems and conditionsTest different promoters, hosts, and induction parameters
Protein instabilityScreen stabilizing additives and detergentsSystematic testing of detergents, lipids, and buffer conditions
Conformational heterogeneityUse conformation-specific antibodies or nanobodiesGenerate and select stabilizing binding partners
Crystal packing difficultiesConsider lipidic cubic phase crystallizationAlternative crystallization methods for membrane proteins
Size limitations for NMRUse selective isotope labeling strategiesFocus on specific domains or interfaces

Alternatively, researchers might consider cryo-EM for structural studies, which has become increasingly powerful for membrane protein complexes. This approach could be particularly valuable for studying nuoK in the context of the entire NADH-quinone oxidoreductase complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.