Recombinant Rhodococcus sp. ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rhodococcus sp. ATP Synthase Subunit b (atpF)

Rhodococcus sp. ATP synthase subunit b (atpF) is a component of the ATP synthase complex, an enzyme that produces adenosine triphosphate (ATP) . ATP is the primary energy currency in cells, fueling various biochemical reactions . The atpF subunit, specifically, is part of the F0 sector of the ATP synthase, which is embedded in the cell membrane and functions as a proton channel .

Recombinant atpF is produced using genetic engineering techniques, where the gene encoding atpF is inserted into a host organism (e.g., E. coli, yeast, or baculovirus) to produce the protein in large quantities . The recombinant protein can then be isolated and used for research purposes.

Key Properties

PropertyDescription
Protein NameATP synthase subunit b
Alternative NamesATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
Source OrganismRhodococcus jostii (strain RHA1)
Production HostE. coli, Yeast, or Baculovirus
Purity>85% (SDS-PAGE)
Molecular WeightVaries depending on the specific construct and tag
TagHis-tag (N-terminal)
StorageLyophilized form: 12 months at -20°C/-80°C. Liquid form: 6 months at -20°C/-80°C . Avoid repeated freeze-thaw cycles .
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% glycerol for long-term storage .
FunctionComponent of the ATP synthase complex, involved in proton translocation across the membrane .
UniProt IDQ0SGP5

Research Applications

Recombinant Rhodococcus sp. atpF is used in various research applications:

  1. Structural Studies: To determine the structure of the ATP synthase complex and understand its mechanism of action .

  2. Drug Discovery: As a target for developing new drugs against bacterial infections . ATP synthase is essential for the viability of bacteria, making it a promising target for antibacterial agents .

  3. Enzyme Kinetics: To study the kinetics of ATP synthesis and hydrolysis .

  4. Protein-Protein Interactions: To investigate the interactions of atpF with other subunits of the ATP synthase complex .

  5. Vaccine Development: To develop vaccines against pathogens.

Role in ATP Synthase Function

The ATP synthase is a complex enzyme composed of two main parts: F0 and F1 . The F0 sector is embedded in the membrane and acts as a proton channel, while the F1 sector is located in the cytoplasm and catalyzes the synthesis of ATP from ADP and inorganic phosphate .

The atpF subunit is a component of the F0 sector and is essential for its proper assembly and function . It forms part of the stalk that connects the F0 and F1 sectors, and it participates in the proton translocation pathway .

The Significance of Recombinant Production

Producing atpF using recombinant DNA technology allows researchers to obtain large quantities of the protein for research purposes . Recombinant atpF can be used to study the structure and function of the ATP synthase complex, as well as to develop new drugs and therapies .

Considerations for Working with Recombinant atpF

  • Purity: Ensure that the recombinant protein is sufficiently pure for the intended application .

  • Storage: Store the protein properly to maintain its activity and stability . Avoid repeated freeze-thaw cycles.

  • Reconstitution: Follow the manufacturer's instructions for reconstituting the protein .

  • Activity: Verify the activity of the recombinant protein before use .

  • Tag: Be aware of the presence of any tags (e.g., His-tag) that may affect the protein's behavior .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; RHA1_ro01476; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Rhodococcus jostii (strain RHA1)
Target Names
atpF
Target Protein Sequence
MAANIAVLAQEESHNPLLPETYDIVWSIVCLVIVGFVFWKYVLPMFQKVLAERTEQIDGG IKRAEEAQAEAKAALEQYRAQLAEARTEAAQIREDARTQGQQIIAEMKAQAQEESDRIVA AGNNQLVAQRQQIVAELRADLGRTAVDLAEKVIGESLADDVKRAGTVDRFLNELDTIGAN SAAGK
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural and functional role of ATP synthase subunit b (atpF) in Rhodococcus sp.?

    ATP synthase subunit b (atpF) is a critical component of the F₀ sector of the bacterial F-type ATP synthase. In Rhodococcus species, particularly R. jostii strain RHA1, this subunit functions as part of the membrane-embedded F₀ domain that forms the proton channel. The b subunit specifically acts as a peripheral stalk connecting the F₀ and F₁ domains, transmitting conformational changes between the membrane-embedded proton channel and the catalytic sites where ATP synthesis occurs .

    Structurally, the b subunit contains a transmembrane domain at its N-terminus and an extended alpha-helical domain that interacts with the δ subunit of the F₁ sector . This arrangement is essential for maintaining the structural integrity of the ATP synthase complex during the rotational catalysis mechanism that drives ATP synthesis.

  • How should recombinant Rhodococcus sp. ATP synthase subunit b (atpF) be stored and handled for optimal stability?

    According to product specifications for commercially available recombinant Rhodococcus sp. ATP synthase subunit b, optimal storage conditions are as follows:

    FormStorage TemperatureShelf Life
    Liquid-20°C/-80°C6 months
    Lyophilized-20°C/-80°C12 months

    For working with the protein, it is recommended to:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Avoid repeated freezing and thawing cycles

    • Store working aliquots at 4°C for up to one week

    These handling precautions help maintain the structural integrity and functional activity of the recombinant protein for experimental use.

  • What expression systems are most effective for producing recombinant Rhodococcus sp. ATP synthase subunit b?

    Based on the available literature, yeast expression systems have been successfully employed for the production of recombinant Rhodococcus sp. ATP synthase subunit b . Yeast systems offer several advantages for expressing membrane and membrane-associated proteins like atpF:

    • Post-translational modifications similar to those in bacteria

    • Ability to properly fold complex proteins

    • High protein yield compared to bacterial expression systems for certain membrane proteins

    • Eukaryotic quality control mechanisms that can improve protein folding

    When expressing recombinant atpF from Rhodococcus, researchers should consider:

    • Codon optimization for the expression host

    • Addition of appropriate affinity tags to facilitate purification

    • Use of inducible promoters to control expression timing

    • Optimization of growth temperature and induction conditions

    The choice of expression system may need to be tailored to specific experimental requirements, particularly if functional studies of the ATP synthase complex are planned .

Advanced Research Questions

  • What are the key experimental considerations when studying the integration of recombinant Rhodococcus sp. ATP synthase subunit b into functional ATP synthase complexes?

    Studying the integration of recombinant atpF into functional ATP synthase complexes requires careful consideration of several experimental parameters:

    Reconstitution into liposomes:
    ATP synthase components must be properly incorporated into lipid membranes to assess functionality. The methodology used for E. callanderi and other bacterial ATP synthases provides a useful model:

    1. Purify the ATP synthase complex or individual components

    2. Prepare liposomes with appropriate lipid composition

    3. Incorporate the protein into liposomes using detergent-mediated reconstitution

    4. Remove detergent by dialysis or adsorption to biobeads

    5. Verify correct orientation of the incorporated protein using protease protection assays

    Functional assessment methodologies:

    • ATP synthesis assays using artificial ion gradients (ΔΨ and ΔpNa/ΔpH)

    • ATP hydrolysis measurements (0.6-0.8 U/mg is typical for functional reconstituted ATP synthases)

    • Assessment of ion coupling and specificity using ionophores (e.g., valinomycin, ETH2120, TCS)

    Critical controls:

    • Use of specific ATP synthase inhibitors (like efrapeptin) to confirm ATP synthesis is occurring via the ATP synthase complex

    • Assessment of membrane integrity and maintenance of ion gradients

    • Verification that ATP synthesis is dependent on both ADP and the electrochemical gradient

    Research with other bacterial ATP synthases suggests the minimal driving force required for ATP synthesis varies significantly between species (E. callanderi: 87 mV; A. woodii: 90 mV; P. modestum: 120 mV; E. coli: 150 mV), underscoring the importance of appropriate experimental design when studying novel ATP synthases .

  • What mutagenesis approaches can reveal key functional residues in Rhodococcus sp. ATP synthase subunit b?

    Strategic mutagenesis of Rhodococcus sp. ATP synthase subunit b can provide valuable insights into structure-function relationships. Based on research with related ATP synthases, the following approaches are recommended:

    Site-directed mutagenesis strategies:

    1. Alanine scanning: Systematic replacement of amino acids with alanine to identify functionally important residues

    2. Charge reversal mutations: Altering charged residues, particularly in regions interacting with other subunits

    3. Truncation analysis: Creation of N-terminal and C-terminal truncations to define minimal functional domains, similar to the Δ40RquA approach used in other Rhodococcus proteins

    4. Conservative vs. non-conservative substitutions: Comparing effects of similar amino acid substitutions versus dramatically different ones

    Key residues to target:

    • Transmembrane domain residues involved in proton translocation

    • Interface residues that interact with other ATP synthase subunits

    • Residues in the extended alpha-helical domain that contribute to the peripheral stalk function

    • Conserved aspartic acid residues that may be involved in critical functions, as observed with RquA where D118A/D143A mutations abolished activity

    Functional assessment of mutants:

    • Complementation assays in ATP synthase-deficient strains

    • In vitro reconstitution and activity measurements

    • Protein-protein interaction studies to assess effects on complex assembly

    • Structural studies to determine effects on protein conformation

  • How does ATP synthase activity in Rhodococcus sp. respond to environmental stressors, and what methodologies are appropriate for studying these responses?

    ATP synthase activity in Rhodococcus species is influenced by various environmental stressors, making this an important area for research. Based on studies with related Rhodococcus species (R. aetherivorans), several methodologies can be applied:

    Key environmental stressors affecting ATP synthase activity:

    • Metal/metalloid exposure (e.g., arsenite, arsenate)

    • Oxidative stress

    • pH fluctuations

    • Nutrient limitation

    • Temperature variations

    Methodological approaches:

    1. Transcriptomic analysis: RNA-seq to assess changes in atpF expression under stress conditions

    2. ATP synthesis measurements: Quantification of endogenous ATP pools under stress conditions

    3. Glucose consumption analysis: Monitoring changes in central carbon metabolism that may affect ATP synthase activity

    4. Metabolic flux analysis: Tracking carbon flow through central metabolic pathways to identify metabolic rearrangements

    Case study from R. aetherivorans BCP1:

    When exposed to arsenic compounds, R. aetherivorans shows distinct responses:

    ConditionATP SynthesisGlucose ConsumptionGrowth Impact
    Control50% increase at 1hNormalNormal growth
    As(III) exposure80% decrease at 1hReducedGrowth inhibition
    As(V) exposure50% increase at 1hNormalEnhanced growth

    These findings demonstrate that stress responses in Rhodococcus can involve complex metabolic rearrangements, including alternative pathways for ATP synthesis and glucose consumption .

  • What approaches are most effective for studying the assembly process of Rhodococcus sp. ATP synthase complex incorporating the b subunit?

    Studying the assembly of the ATP synthase complex in Rhodococcus sp. requires investigation of both the sequential incorporation of subunits and the conditions affecting assembly. Based on research with other bacterial F-type ATP synthases, the following methodologies are recommended:

    Recommended experimental approaches:

    1. Purification of individual recombinant subunits:

      • Express and purify subunits α, β, δ, γε, and b separately

      • Assess purity using SDS-PAGE and specific antibodies

      • Verify folding using circular dichroism or limited proteolysis

    2. In vitro reconstitution experiments:

      • Combine purified subunits in different orders to determine assembly pathway

      • Use analytical ultracentrifugation to monitor complex formation

      • Apply native gel electrophoresis to identify subcomplexes

      • Employ chemical crosslinking to capture transient interactions

    3. Role of ATP in assembly:

      • Investigate whether ATP acts as a substrate or assembly factor

      • Test assembly efficiency under varying ATP concentrations

      • Compare assembly with non-hydrolyzable ATP analogs

    4. Interaction analysis:

      • Surface plasmon resonance to measure binding kinetics between subunits

      • Isothermal titration calorimetry to determine thermodynamic parameters

      • FRET-based assays to monitor subunit associations in real-time

    5. Factors affecting b subunit incorporation:

      • Membrane integration requirements for the b subunit

      • Role of specific lipids in facilitating proper orientation

      • Timing of b subunit incorporation relative to other F₀ components

    In bacterial systems, ATP synthase assembly follows a well-choreographed, step-wise process. Current research suggests that assembly of the F₁ module begins with the formation of an αβ heterodimer and proceeds through specific subcomplexes before full assembly .

  • How does the energetic efficiency of Rhodococcus sp. ATP synthase compare with that of other bacterial species, and what methodologies best reveal these differences?

    Comparing the energetic efficiency of ATP synthases across bacterial species requires careful measurement of the threshold driving force required for ATP synthesis. Research with ATP synthases from various bacteria provides methodological guidance:

    Comparative energetic thresholds in bacterial ATP synthases:

    Bacterial SpeciesMinimal Required Driving Force (mV)Ion SpecificityStructural Features
    E. callanderi87Na⁺Ancient ATP synthase with V-type c subunits
    A. woodii90Na⁺Hybrid rotor with 9 F-type and 1 V-type c subunits
    P. modestum120Na⁺Standard F-type with one ion binding site per c subunit
    E. coli150H⁺Standard F-type with one ion binding site per c subunit

    Recommended methodologies for Rhodococcus sp. comparisons:

    1. Liposome reconstitution system:

      • Purify ATP synthase complex from Rhodococcus sp.

      • Reconstitute into liposomes with defined lipid composition

      • Create controlled ion gradients using K⁺ diffusion potentials and ion concentration gradients

      • Measure ATP synthesis rates under varying driving forces

    2. Threshold determination:

      • Generate a range of driving forces by manipulating both ΔΨ and ΔpIon components

      • Plot ATP synthesis rate versus total driving force

      • Extrapolate to determine the x-intercept (threshold driving force)

      • Compare with other bacterial species under identical conditions

    3. Component contribution analysis:

      • Assess the relative contributions of ΔΨ and ΔpIon to ATP synthesis

      • Determine whether the enzyme can use either component alone or requires both

      • Compare with other bacterial ATP synthases to identify mechanistic differences

    4. Inhibitor studies:

      • Use specific inhibitors like efrapeptin to confirm ATP synthesis occurs via the ATP synthase

      • Compare inhibition patterns across species to identify structural and functional differences

    These approaches would reveal whether Rhodococcus sp. ATP synthase has unique energetic properties that reflect adaptation to its ecological niche.

Methodological Questions

Key Research Challenges and Future Directions

The study of Recombinant Rhodococcus sp. ATP synthase subunit b (atpF) presents several ongoing challenges and opportunities for future research:

  • Structural characterization at high resolution to understand species-specific features

  • Engineering of enhanced variants for biotechnological applications

  • Integration with systems biology approaches to understand metabolic integration

  • Comparative analysis across diverse Rhodococcus species to understand evolutionary adaptations

  • Development of specific inhibitors or activators as potential antimicrobial targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.