Recombinant Rhodococcus sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant nuoK

Recombinant Rhodococcus sp. NADH-quinone oxidoreductase subunit K (nuoK) is a hydrophobic membrane protein component of the bacterial NADH-quinone oxidoreductase (NDH-1) complex, a proton-translocating enzyme in the respiratory chain. This subunit corresponds to mitochondrial ND4L and plays a critical role in electron transfer and proton pumping. Recombinant nuoK is produced in E. coli (sources ) and is commercially available as a purified protein for research applications.

Key characteristics include:

  • EC Number: 1.6.99.5

  • UniProt ID: Q0S440 (Rhodococcus sp. strain RHA1)

  • Function: Facilitates electron transfer from NADH to quinones and contributes to proton translocation across the membrane .

Research Applications

nuoK is used to study:

  • NDH-1 Mechanism: Mutagenesis of Glu residues clarifies proton translocation pathways .

  • Structural Insights: Comparisons with oomycete quinone oxidoreductases (QORs) reveal substrate-binding pocket variations .

  • ELISA Development: Recombinant nuoK serves as an antigen in diagnostic kits (e.g., CSB-CF605368RLO) .

ApplicationKey FindingsSources
Proton TranslocationGlu-36 is indispensable; loop-1 Arg residues stabilize proton channels.
Structural BiologyTM2/TM3 positioning near Fe-S clusters in peripheral domain .
Diagnostic ToolsELISA kits detect nuoK for biochemical studies .

Key Research Findings

  • Proton-Gated Electron Transfer: Relocation of Glu-36 along TM2 retains activity, suggesting helical phase flexibility in proton translocation .

  • Substrate Specificity: Structural studies of oomycete QORs reveal Tyr/Arg residues stabilizing NADPH, contrasting with nuoK’s broader substrate interactions .

  • Overexpression Effects: While not directly studied in nuoK, NQO1 overexpression in E. coli models highlights redox regulation (e.g., NAD+/NADH ratio modulation) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoK; RHA1_ro05919; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Rhodococcus jostii (strain RHA1)
Target Names
nuoK
Target Protein Sequence
MNPENYLYLSALLFTIGAAGVLIRRNAIIVFMCIELMLNASNLAFVTFARMHGNLDGQVF AFFTMVVAAAEVVVGLAIIMTIFRSRRSASVDDANLLKN
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled to proton translocation across the cytoplasmic membrane; four protons are translocated per two electrons transferred, thereby conserving energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of nuoK within the NADH-quinone oxidoreductase complex in Rhodococcus species?

The nuoK subunit is an integral membrane component of the NADH-quinone oxidoreductase (Complex I) in Rhodococcus species, functioning primarily in the proton translocation pathway. Unlike the sodium-pumping NADH:quinone oxidoreductase (Na+-NQR) found in organisms like Vibrio cholerae, the Rhodococcus enzyme complex primarily translocates protons rather than sodium ions across the cytoplasmic membrane. This distinction is crucial for understanding the bioenergetic mechanisms specific to Rhodococcus species. The subunit contributes to the formation of the membrane domain that couples electron transfer to ion movement, thereby participating in energy conservation through the generation of proton motive force.

Based on structural homology with better-characterized bacterial Complex I systems, nuoK likely contains three transmembrane helices that form part of the proton translocation machinery. The positioning of these helices creates hydrophilic cavities that facilitate the movement of protons across the membrane domain. This structural arrangement is critical for the coupling mechanism that connects electron transfer from NADH to quinone with proton pumping activity. The nuoK subunit works in concert with other membrane subunits (nuoH, nuoJ, nuoL, nuoM, and nuoN) to complete the proton translocation pathway within the complex.

What expression systems are most effective for producing recombinant Rhodococcus sp. nuoK?

Heterologous expression of membrane proteins like nuoK presents significant challenges due to their hydrophobic nature and the requirement for proper membrane insertion. For Rhodococcus sp. nuoK, Escherichia coli remains the most widely used expression host, particularly strains optimized for membrane protein expression such as C41(DE3) and C43(DE3). These strains contain mutations that prevent the toxicity often associated with membrane protein overexpression. When using E. coli, expression vectors containing the T7 promoter system provide controlled induction with IPTG, typically at lower temperatures (16-20°C) to allow proper folding and membrane insertion.

Expression in Rhodococcus species themselves (homologous expression) offers advantages for proper folding and post-translational modifications. Rhodococcus erythropolis or Rhodococcus opacus expression systems using inducible promoters like the thiostrepton-inducible tipA promoter have shown success for membrane proteins. The approach used for the heterodimer of NAD(P)H:quinone oxidoreductase where one subunit was tagged with polyhistidine could be adapted for nuoK expression, enabling efficient purification through stepwise elution with imidazole from a nickel nitrilotriacetate column under nondenaturing conditions .

For structural studies requiring higher yields, insect cell expression systems like Sf9 or High Five cells with baculovirus vectors provide a eukaryotic membrane environment that can enhance proper folding. Cell-free expression systems supplemented with lipids or detergent micelles represent another approach for difficult-to-express membrane proteins like nuoK. This method circumvents cellular toxicity issues and allows direct incorporation into membrane mimetics. When assessing expression systems, researchers should consider not only protein yield but also functional integrity, which can be evaluated through complementation assays in Complex I-deficient mutants.

How can researchers verify the structural integrity of recombinant nuoK?

Verifying the structural integrity of recombinant nuoK requires a multi-faceted approach combining biochemical, spectroscopic, and functional analyses. Circular dichroism (CD) spectroscopy provides a valuable initial assessment of secondary structure, particularly the alpha-helical content expected in this transmembrane subunit. The CD spectra should display characteristic minima at 208 and 222 nm, reflecting the predominantly alpha-helical structure of nuoK. Thermal denaturation profiles obtained through CD can further indicate the stability of the recombinant protein and whether it has achieved a native-like folded state.

Fluorescence-based thermal shift assays, adapted for membrane proteins through the use of environmentally sensitive dyes, can assess the thermal stability of the recombinant nuoK in various buffer conditions. This approach helps optimize storage conditions and identify stabilizing additives. Limited proteolysis, followed by mass spectrometry analysis of the resulting fragments, provides information about accessible regions and domain organization. A properly folded nuoK should show resistance to proteolysis in transmembrane regions while exhibiting more susceptibility in loop regions. The structural verification tools should be complemented with functional assays that examine nuoK's ability to associate with other Complex I subunits or contribute to proton translocation activity.

What methodologies are most effective for studying the proton translocation mechanism of nuoK in Rhodococcus sp.?

Investigating the proton translocation mechanism of nuoK requires sophisticated biophysical techniques that can detect proton movement across membranes with high sensitivity. Site-directed mutagenesis of conserved residues within nuoK, followed by functional assays in reconstituted proteoliposomes, provides a foundation for identifying amino acids directly involved in proton translocation. Potential proton-conducting residues can be identified through sequence alignment with homologous subunits from well-characterized Complex I systems, with particular attention to conserved charged or polar residues within the transmembrane helices. Substitution of these residues with non-protonatable counterparts (e.g., aspartate to asparagine) can reveal their importance in the proton translocation pathway.

Solid-state NMR spectroscopy offers atomic-level insights into protonation states and hydrogen bonding networks within membrane proteins. For nuoK studies, selective isotopic labeling of key residues suspected to participate in proton translocation allows monitoring of chemical shift changes in response to pH gradients or during complex activity. This approach can reveal the pKa values of functionally important residues and their changes during the catalytic cycle. Hydrogen/deuterium exchange mass spectrometry (HDX-MS) provides complementary information by identifying regions with dynamic solvent accessibility, which often correlates with proton transfer pathways. The patterns of deuterium incorporation can map potential proton entry and exit points within the nuoK structure.

Advanced fluorescence techniques, such as pH-sensitive GFP variants fused to nuoK or fluorescent pH indicators encapsulated in proteoliposomes, enable real-time monitoring of proton translocation. These systems can be coupled with stopped-flow equipment to capture rapid kinetics of proton movement initiated by NADH oxidation. Computational approaches including molecular dynamics simulations of nuoK embedded in a lipid bilayer can predict water wire formation and proton hopping pathways. When combined with experimental validation, these simulations provide mechanistic models of how conformational changes in nuoK contribute to vectorial proton transport, potentially revealing a mechanism similar to that proposed for Na+-NQR in V. cholerae, where redox states of cofactors orchestrate movements that control ion translocation .

How do mutations in nuoK affect the electron transfer function of NADH-quinone oxidoreductase in Rhodococcus species?

Mutations in nuoK can significantly impact the electron transfer capacity of NADH-quinone oxidoreductase through indirect effects on the catalytic mechanism. Although nuoK does not directly bind redox cofactors like the flavins or iron-sulfur clusters found in other subunits, its structural integrity is crucial for maintaining the conformational coupling between electron transfer in the peripheral arm and proton translocation in the membrane domain. Systematic alanine scanning mutagenesis of nuoK can identify residues essential for this coupling mechanism. Researchers should particularly target conserved polar or charged residues within transmembrane segments, as these often serve as relay points in the proton translocation pathway that responds to electron movement.

Electron paramagnetic resonance (EPR) spectroscopy offers additional insights by directly monitoring the redox states of paramagnetic centers such as iron-sulfur clusters and flavin radicals during catalysis. Changes in the EPR signals between wild-type and nuoK mutants can reveal alterations in the electronic environment of these cofactors, potentially indicating disrupted coupling between electron transfer and proton pumping. When these spectroscopic approaches are combined with structural analysis through cryo-electron microscopy of the intact complex, researchers can correlate functional defects with specific structural perturbations caused by nuoK mutations. This comprehensive analysis helps elucidate how the relatively small nuoK subunit contributes to the remarkable energy transduction efficiency of Complex I.

What is the relationship between nuoK structure and antimicrobial resistance in Rhodococcus species?

The relationship between nuoK structure and antimicrobial resistance in Rhodococcus species represents an emerging area of research with significant clinical implications. NADH-quinone oxidoreductase is a potential target for antimicrobial compounds, as disruption of cellular bioenergetics can effectively inhibit bacterial growth. Structural variations in nuoK might contribute to intrinsic resistance against such inhibitors through altered binding sites or access pathways. Comparative genomic analysis of nuoK sequences from antimicrobial-resistant versus susceptible Rhodococcus strains can identify amino acid substitutions potentially associated with resistance phenotypes. These analyses should focus particularly on regions analogous to known inhibitor binding sites in Complex I from other organisms.

Experimental validation of the relationship between nuoK and antimicrobial resistance can be pursued through heterologous expression of nuoK variants in susceptible strains. If specific nuoK alleles confer increased resistance, this would support its direct involvement in resistance mechanisms. Molecular docking studies using homology models of Rhodococcus nuoK can predict interactions with known Complex I inhibitors and how specific mutations might disrupt these interactions. These computational predictions should be validated through binding assays using purified recombinant proteins. The antimicrobial susceptibility patterns observed in Rhodococcus equi, particularly the effectiveness of erythromycin, gentamycin, vancomycin, and rifampin , may partially reflect how these antibiotics interact with respiratory complexes including NADH-quinone oxidoreductase.

The broader metabolic consequences of nuoK-mediated resistance require investigation through metabolomic and proteomic approaches. If nuoK mutations reduce the efficiency of NADH-quinone oxidoreductase, bacteria might upregulate alternative respiratory pathways or adopt more fermentative metabolism to compensate. Such metabolic remodeling could contribute to multidrug resistance by reducing cellular dependence on respiratory chain function. Understanding this relationship has therapeutic implications, as combinatorial approaches targeting both primary antimicrobial targets and bioenergetic compensatory mechanisms could overcome resistance. This research direction is particularly relevant for pathogenic Rhodococcus species like R. equi, which causes significant respiratory disease in foals and occasionally in immunocompromised humans.

What are the optimal conditions for functional reconstitution of recombinant nuoK into proteoliposomes?

Successful functional reconstitution of recombinant nuoK into proteoliposomes requires careful optimization of multiple parameters to achieve physiologically relevant activity. The lipid composition represents a critical factor, as the native membrane environment of Rhodococcus species differs from model bacterial systems. A mixture of E. coli polar lipids supplemented with cardiolipin at 10-15% provides a suitable starting point, as cardiolipin is known to interact with respiratory complexes in many bacteria. Researchers should systematically vary the phospholipid composition, testing the inclusion of phosphatidylglycerol, phosphatidylethanolamine, and phosphatidylcholine at different ratios while monitoring reconstitution efficiency and functional activity. The lipid-to-protein ratio requires careful optimization, typically starting at 100:1 (w/w) and adjusting based on activity measurements and physical characterization of the proteoliposomes.

The reconstitution method significantly impacts functional outcomes, with detergent-mediated reconstitution being the most widely employed approach. For nuoK, mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are preferred for solubilization, followed by controlled detergent removal using bio-beads, dialysis, or cyclodextrin. Each detergent removal method presents distinct kinetics that influence protein orientation and distribution in the resulting proteoliposomes. The buffer composition during reconstitution should mirror physiological conditions in Rhodococcus, with particular attention to pH (typically 7.0-7.5), ionic strength (100-150 mM KCl or NaCl), and the presence of stabilizing agents like glycerol (5-10%). The temperature during reconstitution should be maintained above the phase transition temperature of the lipid mixture but below levels that might denature the protein, typically 25-30°C for most phospholipid mixtures.

Functional validation of nuoK reconstitution presents a significant challenge, as the subunit alone may not display measurable activity without the context of the complete Complex I. Co-reconstitution with other essential subunits may be necessary to observe proton translocation activity. Researchers can employ pH-sensitive fluorescent dyes encapsulated within proteoliposomes to monitor proton movement, or potentiometric dyes to detect membrane potential generation. If co-reconstituted with catalytic subunits, NADH oxidation activity can be monitored spectrophotometrically. The orientation of reconstituted nuoK can be determined through protease digestion assays, exploiting the differential accessibility of epitope tags placed on predicted loop regions. Achieving homogeneous orientation is crucial for meaningful functional studies, as random orientation would result in competing proton fluxes that mask the vectorial nature of the transport process.

How can researchers effectively analyze the interaction between nuoK and other subunits of Complex I?

Analyzing the interactions between nuoK and other Complex I subunits requires a systematic approach combining genetic, biochemical, and biophysical techniques. Cross-linking studies using chemical cross-linkers with varying spacer lengths can capture direct interactions between nuoK and neighboring subunits. These experiments should be performed both in isolated membrane fractions and with purified components, followed by mass spectrometry analysis to identify cross-linked peptides. Zero-length cross-linkers like carbodiimides are particularly valuable for detecting amino acids in direct contact, while longer cross-linkers can reveal more dynamic interactions. This approach has proven effective in mapping subunit interactions in other multiprotein complexes and could reveal how nuoK integrates within the membrane domain of Complex I.

Co-immunoprecipitation experiments provide complementary evidence of protein-protein interactions within the native cellular environment. By expressing epitope-tagged versions of nuoK in Rhodococcus species or appropriate heterologous hosts, researchers can pull down the tagged protein along with interacting partners. Mass spectrometry identification of the co-precipitated proteins reveals the interaction network of nuoK within the complex. Surface plasmon resonance or microscale thermophoresis with purified components allows quantitative measurement of binding affinities between nuoK and other subunits, providing insights into the hierarchy of assembly and the strength of various interactions within the complex. The approach used in the analysis of NAD(P)H:quinone oxidoreductase heterodimers, where subunits with different tags were co-expressed and purified, offers a valuable methodology for studying these interactions .

Advanced structural biology techniques provide the most detailed view of subunit interactions. Cryo-electron microscopy of the intact Complex I at various stages of assembly can reveal the structural role of nuoK and its contacts with other subunits. Chemical shift perturbation experiments using NMR spectroscopy with isotopically labeled nuoK can map interaction surfaces when titrated with partner subunits. For functional characterization of these interactions, complementation assays in bacterial strains with deleted or mutated nuoK can assess whether co-expression of interacting subunits rescues complex assembly or activity. The combined results from these approaches will generate a comprehensive model of how nuoK contributes to the structural integrity and functional dynamics of Complex I in Rhodococcus species.

What are the main challenges in obtaining high-resolution structural data for nuoK, and how can they be overcome?

Obtaining high-resolution structural data for membrane proteins like nuoK presents multiple challenges stemming from their hydrophobic nature, conformational flexibility, and tendency to aggregate. The small size of nuoK (approximately 100 amino acids) further complicates structural studies, as it provides limited surface area for crystal contacts in X-ray crystallography approaches. To overcome these challenges, researchers can employ a divide-and-conquer strategy, focusing initially on obtaining the structure of nuoK within smaller subcomplexes of the membrane domain rather than attempting to crystallize it in isolation. This approach has proven successful for other membrane protein complexes where individual subunits proved recalcitrant to crystallization.

For X-ray crystallography, lipidic cubic phase (LCP) or bicelle crystallization methods have shown particular promise for membrane proteins with multiple transmembrane helices. These techniques provide a more native-like membrane environment that can stabilize nuoK in a physiologically relevant conformation. Fusion with crystallization chaperones such as T4 lysozyme or BRIL (thermostabilized apocytochrome b562) inserted into loop regions can provide additional hydrophilic surfaces for crystal contacts without disrupting the transmembrane regions. Antibody fragments (Fab or nanobody) that recognize specific epitopes on nuoK represent another strategy to enhance crystallizability by increasing the hydrophilic surface area and potentially stabilizing specific conformations. The extensive protein engineering required for these approaches necessitates careful validation to ensure that the modifications do not alter the native structure or function.

Nuclear Magnetic Resonance (NMR) spectroscopy offers an alternative approach for structural determination, particularly solution NMR for detergent-solubilized nuoK or solid-state NMR for reconstituted proteoliposomes or nanodiscs. The relatively small size of nuoK makes it amenable to solution NMR studies, though extensive isotopic labeling (15N, 13C, and potentially 2H) is required for sufficient resolution. Recent advances in cryo-electron microscopy (cryo-EM) have revolutionized membrane protein structural biology, with increasing resolution now possible even for smaller proteins. For nuoK, cryo-EM may be most effective when pursuing the structure of larger subcomplexes or the entire Complex I, as demonstrated in the structural studies of Na+-NQR from V. cholerae . The integration of computational approaches, including molecular dynamics simulations and homology modeling based on structures from related organisms, can complement experimental methods to produce a comprehensive structural model of nuoK and its interactions within Complex I.

What analytical techniques best characterize the redox properties of the NADH-quinone oxidoreductase complex containing recombinant nuoK?

Characterizing the redox properties of NADH-quinone oxidoreductase containing recombinant nuoK requires a combination of spectroscopic, electrochemical, and functional techniques that can probe different aspects of electron transfer and energy coupling. Protein film voltammetry represents a powerful approach for directly measuring the redox potentials of the various cofactors within the complex. By immobilizing the purified complex on an electrode surface, researchers can observe electron transfer to and from the enzyme as changes in current at different applied potentials. This technique reveals the thermodynamic landscape of electron flow through the complex and can identify how nuoK mutations might alter these properties, potentially through long-range conformational effects that modify cofactor environments.

Spectroscopic techniques provide complementary information about the electronic structure and environment of redox cofactors. UV-visible spectroscopy can track the redox state of flavin cofactors, while EPR spectroscopy is particularly valuable for studying paramagnetic centers like iron-sulfur clusters and flavin radicals. The redox-dependent EPR signals from these centers serve as internal probes of electron movement through the complex. Resonance Raman spectroscopy offers additional insights into the vibrational modes of cofactors, which are sensitive to their redox state and protein environment. These spectroscopic methods can be applied under steady-state conditions or combined with rapid mixing techniques to capture transient intermediates during catalysis. The combination of steady-state kinetics with spectroscopic analysis was successfully employed to characterize the heterodimeric NAD(P)H:quinone oxidoreductase, an approach that could be adapted for studying complexes containing recombinant nuoK .

For investigating the complete electron transfer pathway, including quinone reduction, HPLC analysis of quinone content before and after reaction with NADH provides quantitative assessment of substrate conversion. Combining these analytical techniques with site-directed mutagenesis of nuoK and neighboring subunits allows researchers to map how structural perturbations propagate to affect redox properties. This integrated approach reveals the remarkable long-range coupling between the membrane domain, where nuoK resides, and the peripheral arm containing most redox cofactors. The redox characterization should be performed under various conditions, including different pH values and in the presence of inhibitors, to fully understand how environmental factors influence electron transfer through the complex. The data can be compiled into a comprehensive model of electron flow that explains how the redox chemistry of Complex I is coupled to proton translocation, with specific attention to nuoK's role in this energy transduction process.

How should researchers interpret conflicting data regarding nuoK function across different Rhodococcus species?

Interpreting conflicting data regarding nuoK function across different Rhodococcus species requires a systematic approach that considers evolutionary, methodological, and physiological factors. Phylogenetic analysis of nuoK sequences from various Rhodococcus species provides an evolutionary context for functional differences. Researchers should construct maximum likelihood phylogenetic trees based on both nuoK sequences alone and concatenated sequences of all Complex I subunits. The resulting trees can reveal whether functional divergence correlates with evolutionary distance or horizontal gene transfer events. Species-specific sequence motifs identified through sequence logo analysis of aligned nuoK proteins may highlight regions responsible for functional differences.

Physiological adaptation to different ecological niches may explain genuine functional differences in nuoK across Rhodococcus species. Researchers should correlate functional properties with the natural habitat and metabolic capabilities of each species. For instance, species adapted to fluctuating oxygen levels might show different regulatory properties in their respiratory chain components. The table below summarizes approaches for resolving conflicting data on nuoK function:

ApproachMethodologyExpected OutcomeLimitations
Phylogenetic analysisMaximum likelihood trees of nuoK sequencesEvolutionary context for functional differencesLimited by sequence availability
Standardized functional assaysParallel testing of nuoK from different speciesDirect comparison under identical conditionsResource-intensive
Chimeric protein analysisDomain swapping between nuoK proteinsIdentification of regions responsible for functional differencesMay disrupt protein folding
Ecological correlationComparison of nuoK properties with species habitatInsights into adaptive significanceEcological data may be incomplete
Structural comparisonHomology modeling based on high-resolution structuresMolecular basis for functional differencesModels require experimental validation

By systematically addressing these factors, researchers can distinguish genuine biological variation from technical artifacts and develop a more nuanced understanding of nuoK function across the Rhodococcus genus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.