Recombinant Rhodococcus sp. Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Role and Biological Significance

Lgt is indispensable for bacterial viability, as its deletion disrupts lipoprotein maturation, leading to cell envelope defects and increased susceptibility to antibiotics . In Rhodococcus spp., lipoproteins contribute to virulence, environmental adaptation, and bioremediation . For example:

  • Rhodococcus equi requires lipoproteins for intracellular survival in macrophages .

  • Recombinant Rhodococcus strains engineered for biodegradation rely on functional lipoproteins for substrate uptake .

Recombinant Expression and Genetic Engineering

Recombinant Rhodococcus sp. Lgt has been explored using Rhodococcus-E. coli shuttle vectors, as demonstrated in studies on nitrile hydratase and desulfurization pathways :

  • Vector systems: Plasmid pK4 and derivatives enable heterologous expression in Rhodococcus hosts .

  • Inducible promoters: Putative rrn promoters regulate gene expression, as shown in Rhodococcus sp. T09 .

  • Functional assays: GFP-based in vitro assays (validated for EcLgt ) could be adapted to measure diacylglyceryl transfer activity in recombinant Rhodococcus strains.

Bioremediation

Recombinant Rhodococcus strains engineered with pollutant-degrading operons (e.g., 4-chlorobiphenyl metabolism) require functional Lgt for lipoprotein-dependent substrate uptake :

  • Case study: A Rhodococcus sp. RHA1 strain expressing 4-chlorobenzoate degradation genes achieved 90% substrate conversion in soil .

Antibiotic Development

Lgt is a promising target for novel antibiotics. Inhibitors identified for EcLgt (e.g., palmitic acid analogs ) could inform drug discovery for Rhodococcus-associated infections .

Challenges and Future Directions

  • Structural gaps: No crystal structure exists for Rhodococcus sp. Lgt, limiting mechanistic studies.

  • Regulatory networks: Rhodococcus lipoprotein expression may involve virulence plasmids (e.g., R. equi 85-kb plasmid ), complicating recombinant systems.

  • Industrial scaling: Optimizing Lgt activity in bioremediation strains requires balancing enzyme expression with host fitness .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it.
Synonyms
lgt; RHA1_ro01011; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Rhodococcus jostii (strain RHA1)
Target Names
lgt
Target Protein Sequence
MTSTVDVLAYIPSPPQGVWYVGPVALRAYALFIIVGIVVAIVWGDRRWVARGGEKGTVLD IAIWAVPFGLIGGRLYHVMTDWPTYFGEGGDPVDALKVWQGGLGIWGAVALGGVGAWIGC RRRGIPLPALGDAVAPAILLAQAIGRLGNYFNQELYGRETEVPWGLEIFERRNDVGQVSP QLIDGVSTGEVAFVVHPTFLYEALWNVLIVLLLVWVDRRFRIGHGRLFALYVAGYCAGRF WIELMRSDHASLIAGVRVNSFTSALVFVAALVYFFAATKGREDPAELRPADGGPVGGGGE PVDGEIAQKEPEKNVEDAGKDEGTSASEPVSDDKAASTASTGGEAGTKTIDSKKDDAND
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of prolipoprotein diacylglyceryl transferase (Lgt) in bacterial systems?

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to prolipoproteins, specifically to the sulfhydryl side chain of the invariant cysteine residue (Cys+1) in the lipobox motif . This represents the first critical step in bacterial lipoprotein biogenesis, where the diacylglyceryl modification anchors the lipoprotein to the membrane . In subsequent steps, the signal peptide is cleaved by lipoprotein signal peptidase (LspA), freeing the α-amino group of Cys+1 for potential further modifications .

The enzymatic reaction catalyzed by Lgt can be represented as:

Phosphatidylglycerol + Prolipoprotein → Prolipoprotein-diacylglyceryl + Glycerol phosphate

This reaction is essential for the proper localization and function of numerous lipoproteins involved in cell envelope architecture, membrane stability, nutrient transport, and virulence .

How does Rhodococcus sp. Lgt compare structurally with characterized homologs?

Based on comparative analysis with E. coli Lgt, Rhodococcus sp. Lgt likely shares several conserved structural features while potentially exhibiting adaptations specific to its actinobacterial cell envelope. The E. coli Lgt crystal structure revealed seven transmembrane segments with its N-terminus facing the periplasm and its C-terminus in the cytoplasm . The enzyme contains two substrate binding sites and a highly conserved "Lgt signature motif" that faces the periplasm .

Structurally important residues identified in E. coli include:

ResidueFunctionConservationEffect when mutated
Y26CatalyticInvariantComplete loss of function
R143Substrate bindingHighly conservedSeverely impaired function
N146CatalyticInvariantComplete loss of function
E151StabilityHighly conservedImpaired function
G154StructuralInvariantComplete loss of function
R239Substrate bindingHighly conservedSeverely impaired function
E243StabilityHighly conservedImpaired function

Rhodococcus sp. Lgt likely shares these conserved residues, though the precise structural adaptations that might accommodate differences in membrane composition and substrate specificity require experimental verification .

What expression systems are suitable for recombinant Rhodococcus sp. Lgt production?

For recombinant Rhodococcus sp. Lgt expression, several systems can be considered, each with particular advantages:

  • Homologous expression in Rhodococcus: This approach utilizes the native cellular machinery, providing proper membrane insertion and folding. Inducible promoter systems like the acetamidase or thiostrepton-inducible promoters can be employed.

  • E. coli expression systems: While potentially higher-yielding, expressing Rhodococcus Lgt in E. coli presents challenges due to its integral membrane nature. Options include:

    • C41/C43(DE3) strains specifically designed for membrane protein expression

    • Fusion with maltose-binding protein (MBP) or thioredoxin to enhance solubility

    • Use of mild induction conditions (lower IPTG concentrations, reduced temperature)

  • Cell-free expression systems: These can circumvent some challenges of membrane protein expression by providing controlled environments with supplied detergents or lipid nanodiscs .

The choice should be guided by the intended application. For structural studies requiring larger quantities, E. coli or cell-free systems with appropriate detergents may be preferable. For functional studies, a homologous Rhodococcus system might better preserve native activity.

How can recombinant Rhodococcus sp. Lgt activity be measured in vitro?

Multiple approaches can be implemented to measure recombinant Lgt activity:

  • Glycerol phosphate release assay: This measures the release of glycerol phosphate (G1P/G3P) as a byproduct of the diacylglyceryl transfer reaction. Detection can be accomplished via coupled enzymatic reactions with luciferase systems for high sensitivity . A typical reaction mixture contains:

    • Purified recombinant Lgt in appropriate detergent (0.02% n-dodecyl β-D-maltoside)

    • Phosphatidylglycerol substrate (50-200 μM)

    • Synthetic peptide substrate containing the lipobox motif (e.g., Pal-IAAC)

    • Appropriate buffer system (typically Tris-based, pH 7.5-8.0)

  • Radiolabeled lipid incorporation: Using 14C-palmitate-labeled phosphatidylglycerol and measuring incorporation into peptide substrates via scintillation counting .

  • Fluorescently-labeled substrate assay: Employing FRET-based detection systems or environmentally sensitive fluorophores to monitor substrate modification.

  • HPLC/MS-based assays: For direct detection of modified peptide products and reaction kinetics analysis.

For all assays, proper controls should include a negative control using a peptide with the conserved cysteine mutated to alanine (e.g., Pal-IAAA) which should show negligible activity .

What strategies can overcome expression challenges for membrane-bound Rhodococcus sp. Lgt?

Expressing functional Rhodococcus sp. Lgt presents several challenges requiring systematic optimization:

  • Detergent screening and optimization: Begin with a panel of detergents at various concentrations:

    • Mild detergents (DDM, LMNG, Brij-35)

    • Zwitterionic detergents (LDAO, Fos-choline)

    • Combination approaches with cholesterol hemisuccinate

    Detergent screening should assess both extraction efficiency and retention of enzymatic activity.

  • Lipid supplementation strategies:

    • Addition of Rhodococcus-derived lipid extracts

    • Supplementation with defined phospholipids (particularly phosphatidylglycerol)

    • Reconstitution into nanodiscs or liposomes post-purification

  • Fusion protein approaches:

    • N-terminal fusions (MBP, thioredoxin) with engineered cleavage sites

    • Split-intein mediated approaches for post-translational removal of fusion partners

  • Codon optimization: Target-specific codon optimization enhances expression by:

    • Adjusting for the heterologous host's codon usage bias

    • Eliminating rare codons at the 5' end of the transcript

    • Optimizing mRNA secondary structure near the ribosome binding site

An experimental design for expression optimization would involve a multifactorial approach varying temperature (16-30°C), inducer concentration, and expression duration, followed by activity assessments rather than simply protein yield evaluation .

How do mutations in conserved residues affect Rhodococcus sp. Lgt function?

Based on studies with E. coli Lgt, strategic mutagenesis of conserved residues provides valuable structure-function insights. Predicted effects in Rhodococcus sp. Lgt would include:

MutationPredicted EffectExperimental Verification Approach
Y26AComplete loss of catalytic activityIn vitro activity assays with purified mutant enzyme
R143ASeverely reduced substrate bindingSubstrate binding assays using radiolabeled phosphatidylglycerol
N146AAbolished catalytic activityComplementation assays in Lgt-depleted strains
G154ADisrupted protein folding/stabilityCircular dichroism and thermal shift assays
R239AImpaired product releaseKinetic analysis examining product inhibition effects

To systematically investigate these effects, a complementation approach similar to that used for E. coli can be employed, where an Lgt-depleted Rhodococcus strain is complemented with plasmids expressing mutant variants .

Additionally, hydrogen-deuterium exchange mass spectrometry could identify conformational changes resulting from these mutations, providing insight into their mechanistic roles beyond simple activity measurements.

What approaches are effective for developing specific inhibitors of Rhodococcus sp. Lgt?

Developing specific inhibitors for Rhodococcus sp. Lgt requires multi-faceted approaches:

  • Structure-based design strategies:

    • Homology modeling based on the E. coli Lgt crystal structure

    • Molecular dynamics simulations to identify binding pocket dynamics

    • Virtual screening of compound libraries targeting the substrate binding sites

  • High-throughput screening approaches:

    • Adaptation of the glycerol phosphate release assay to a miniaturized format

    • Fluorescence-based binding assays using environmentally sensitive probes

    • Displacement assays using fluorescently labeled substrate analogs

  • Macrocyclic peptide screening:

    • mRNA display techniques with non-canonical amino acids

    • Selection against biotinylated Rhodococcus Lgt

    • Affinity maturation through iterative selection rounds

  • Rational design of transition-state analogs:

    • Phosphonate-based inhibitors mimicking the reaction transition state

    • Non-hydrolyzable phosphatidylglycerol analogs with modified linkages

Recently identified Lgt inhibitors demonstrated potent activity against E. coli and A. baumannii, with IC50 values of 0.18-0.93 μM. These compounds showed bactericidal activity through on-target mechanisms and, importantly, were not subject to resistance via deletion of major outer membrane lipoproteins (lpp), unlike inhibitors targeting downstream steps of lipoprotein biosynthesis .

How does the essentiality of lgt vary across bacterial species and what are the implications for Rhodococcus research?

Lgt essentiality varies significantly across bacterial taxa, with important implications for Rhodococcus research:

Bacterial SpeciesLgt EssentialityPhenotype of lgt Deletion/DepletionReference
E. coli (Gram-negative)EssentialGrowth arrest, membrane permeabilization
B. anthracis (Gram-positive)Non-essentialReduced virulence, inefficient spore germination
C. glutamicum (Actinobacteria)Non-essentialAltered membrane properties

As Rhodococcus is phylogenetically related to Corynebacterium (both belonging to the Actinobacteria phylum), the lgt gene in Rhodococcus may also be non-essential. This pattern suggests that:

  • The essential nature of Lgt correlates with cell envelope architecture complexity.

  • In Gram-negative bacteria (like E. coli), Lgt is typically essential due to the critical role lipoproteins play in outer membrane integrity.

  • In certain Gram-positive bacteria and Actinobacteria, alternative membrane stabilization mechanisms may exist.

For Rhodococcus research, these differences suggest that:

  • Genetic manipulation of lgt may be feasible without complete growth inhibition

  • Phenotypic consequences might involve altered cell wall permeability, biofilm formation, or stress responses

  • Potential for developing Rhodococcus-specific conditional knockdown systems to study Lgt function

These variations in essentiality also impact antimicrobial development strategies, as targeting Lgt would likely have different efficacy profiles across bacterial genera.

What methodologies can characterize the substrate specificity of Rhodococcus sp. Lgt?

Understanding the substrate specificity of Rhodococcus sp. Lgt requires comprehensive analytical approaches:

  • Phospholipid substrate preference analysis:

    • Competition assays using various phospholipids (phosphatidylglycerol, phosphatidylethanolamine, cardiolipin)

    • Mass spectrometry-based quantification of substrate utilization rates

    • Analysis of acyl chain preferences using defined synthetic phospholipids

  • Lipobox peptide recognition studies:

    • Synthetic peptide libraries with systematic variations in the lipobox motif

    • Positional scanning to identify critical determinants beyond the conserved cysteine

    • Quantitative structure-activity relationship (QSAR) analysis

  • Native substrate identification:

    • Comparative lipidomic analysis of wild-type and Lgt-depleted Rhodococcus

    • Proteomic identification of lipoproteins using metabolic labeling approaches

    • Pull-down assays with catalytically inactive Lgt variants

  • In vitro reconstitution experiments:

    • Expression and purification of candidate Rhodococcus prolipoproteins

    • Development of a GFP-based in vitro assay similar to that used for E. coli Lgt

    • Direct monitoring of substrate-enzyme interactions using surface plasmon resonance or microscale thermophoresis

These approaches would reveal whether Rhodococcus sp. Lgt exhibits distinct substrate preferences compared to its homologs in other bacterial species, potentially identifying unique features that could be exploited for species-specific targeting.

How can activity loss during Rhodococcus sp. Lgt purification be minimized?

Activity preservation during purification remains a significant challenge for membrane-bound enzymes like Lgt. A systematic approach includes:

  • Optimized solubilization conditions:

    • Use of milder detergents at minimal effective concentrations

    • Brief solubilization periods at lower temperatures (4°C)

    • Addition of glycerol (10-20%) and reducing agents to prevent oxidation

    • Inclusion of Rhodococcus-derived lipid extracts in all buffers

  • Strategic purification protocols:

    • Limiting exposure to harsh conditions (extreme pH, high salt)

    • Employing affinity chromatography with engineered tags positioned away from functional domains

    • Using size exclusion chromatography as a final polishing step to ensure homogeneity

    • Maintaining constant detergent concentrations above the critical micelle concentration

  • Activity-guided fractionation:

    • Regular activity testing throughout purification

    • Retention of active fractions regardless of apparent purity

    • Immediate reconstitution into proteoliposomes post-purification

  • Storage optimization:

    • Flash-freezing in small aliquots with cryoprotectants

    • Storage in 50% glycerol at -20°C rather than -80°C to prevent detergent precipitation

    • Avoiding repeated freeze-thaw cycles

What factors influence reproducibility in Rhodococcus sp. Lgt enzymatic assays?

Several factors can impact assay reproducibility:

  • Substrate preparation consistency:

    • Standardized phospholipid preparation methods (sonication, extrusion)

    • Verification of phospholipid vesicle size distribution

    • Careful handling of peptide substrates to prevent oxidation or aggregation

  • Enzyme stability considerations:

    • Strict temperature control throughout the assay

    • Consistent enzyme:substrate ratios

    • Minimal delay between enzyme preparation and assay initiation

  • Assay buffer optimization:

    • Evaluation of buffer components affecting activity (ionic strength, divalent cations)

    • Determination of optimal pH range specific to Rhodococcus Lgt

    • Assessment of potential inhibitory compounds in buffer components

  • Detection method validation:

    • Establishing linear response ranges for all detection methods

    • Regular calibration with defined standards

    • Use of internal controls to normalize between experiments

A systematic method validation approach should include reproducibility assessment under various conditions, including different enzyme preparations, substrate batches, and environmental factors to ensure robust, consistent results.

How can contradictory results in Lgt essentiality studies be reconciled?

Conflicting observations regarding Lgt essentiality across different studies may stem from:

  • Methodological differences:

    • Direct gene deletion versus conditional depletion approaches

    • Growth media composition affecting phenotypic expression

    • Incubation conditions (temperature, oxygen availability)

  • Strain-specific variations:

    • Laboratory-adapted versus clinical/environmental isolates

    • Background mutations affecting synthetic lethality

    • Spontaneous suppressor mutations

  • Functional redundancy considerations:

    • Presence of paralogous genes with overlapping functions

    • Alternative lipidation pathways in certain bacteria

    • Compensatory mechanisms that arise during adaptation

To reconcile contradictory results, researchers should:

  • Employ multiple complementary approaches (gene deletion, depletion, chemical inhibition)

  • Thoroughly characterize growth conditions influencing essentiality

  • Perform comprehensive genomic analysis to identify potential compensatory mutations

  • Consider evolutionary relationships between species with different essentiality patterns

What structural studies would advance understanding of Rhodococcus sp. Lgt function?

Critical structural biology approaches include:

  • High-resolution structure determination:

    • Cryo-electron microscopy of Lgt in nanodiscs or amphipols

    • X-ray crystallography with stabilizing antibody fragments

    • Solid-state NMR studies of reconstituted enzyme

  • Dynamic structural analyses:

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

    • Single-molecule FRET to monitor conformational changes during catalysis

    • Molecular dynamics simulations to predict substrate binding pathways

  • Complex formation studies:

    • Co-crystallization with substrate analogs or inhibitors

    • Crosslinking coupled with mass spectrometry to identify interaction interfaces

    • In-cell studies of Lgt interactions with nascent lipoproteins

These approaches would reveal how Rhodococcus sp. Lgt's structure relates to its function, potentially identifying species-specific features that could guide targeted inhibitor development.

How can Rhodococcus sp. Lgt research inform antimicrobial development?

The potential of Lgt as an antimicrobial target shows promise for several reasons:

  • Unique resistance profiles:

    • Unlike inhibitors of downstream steps in lipoprotein processing, Lgt inhibitors remain effective even when major lipoproteins are deleted

    • The essential nature of Lgt in many pathogens reduces straightforward resistance development

  • Rational drug design opportunities:

    • The lateral access model for substrate entry/exit suggests specific inhibitor design strategies

    • Targeting the conserved "Lgt signature motif" could yield broad-spectrum inhibitors

    • Exploiting species-specific substrate preferences could enable selective targeting

  • Combined therapeutic approaches:

    • Lgt inhibitors sensitize bacteria to other antibiotics through membrane permeabilization

    • Potential synergistic combinations with outer membrane-targeting antimicrobials

    • Opportunities for adjuvant development to enhance existing antibiotic efficacy

Research on Rhodococcus sp. Lgt could provide valuable insights for treating related actinobacterial pathogens like Mycobacterium tuberculosis, where novel antimicrobial targets are urgently needed.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.