Recombinant Rhodococcus sp. UPF0060 membrane protein RHA1_ro06609 (RHA1_ro06609)

What is the basic structure and properties of Recombinant Rhodococcus sp. UPF0060 membrane protein RHA1_ro06609?

RHA1_ro06609 is a full-length (1-109 amino acids) membrane protein derived from Rhodococcus jostii. The protein has a specific amino acid sequence: MTVAKSVALFAVAALFEIGGAWLVWQGVREHRGWIWIGAGVAALGAYGFVATLQPDAHFGRILAAYGGVFVAGSLIWGMVADGFRPDRWDVSGALICLLGMAVIMYAPR. Based on structural analysis, the protein contains multiple transmembrane domains characteristic of membrane-associated proteins. The commercially available recombinant version typically includes an N-terminal His-tag to facilitate purification and detection .

The protein's hydrophobic regions suggest it integrates into membranes, with alternating hydrophobic and hydrophilic segments forming transmembrane helices. When analyzing this protein in research contexts, it's important to consider these structural properties as they significantly influence experimental design, especially for solubilization and functional studies.

What expression systems are suitable for RHA1_ro06609 production?

The recombinant RHA1_ro06609 protein is typically expressed in E. coli expression systems, which provide high yield and relatively straightforward protocols for membrane protein production . The E. coli system is preferred due to its rapid growth, well-characterized genetics, and various available strains optimized for membrane protein expression.

When designing your expression protocol, consider the following methodological approaches:

• Strain selection: BL21(DE3), C41(DE3), or C43(DE3) strains are often preferred for membrane proteins

• Temperature optimization: Lower temperatures (16-25°C) during induction often improve proper folding

• Inducer concentration: Titrating IPTG concentration can help balance expression yield and proper folding

• Media formulation: Addition of glycerol (0.5-2%) can enhance membrane protein expression

• Co-expression with chaperones: May improve folding and prevent aggregation

While E. coli remains the predominant system, for specialized applications requiring post-translational modifications, insect cell or mammalian expression systems could be considered, though these would require significant protocol adaptations.

What are the optimal storage conditions for maintaining RHA1_ro06609 stability?

The lyophilized powder form of RHA1_ro06609 should be stored at -20°C/-80°C upon receipt. After reconstitution, working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and store in small aliquots at -20°C/-80°C.

For optimal results, implement the following methodological storage protocol:

• Briefly centrifuge the vial before opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 50% to prevent freeze-damage

• Divide into small single-use aliquots to avoid repeated freeze-thaw cycles

• Store aliquots at -80°C for maximum stability

• Track freeze-thaw cycles and time at 4°C for each aliquot to maintain experimental consistency

These precautions are particularly important for membrane proteins like RHA1_ro06609, which tend to be more susceptible to denaturation and aggregation than soluble proteins.

How should RHA1_ro06609 be reconstituted for experimental use?

Proper reconstitution is crucial for maintaining the functional integrity of RHA1_ro06609. The recommended protocol involves the following steps: First, centrifuge the vial containing lyophilized protein briefly before opening to ensure the powder is at the bottom. Then, reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL .

For membrane protein applications requiring functional studies, consider these methodological refinements:

• Use a buffer system that mimics physiological conditions (e.g., PBS-based buffer, pH 7.4-8.0)

• Add mild detergents to maintain protein solubility (e.g., 0.1% DDM, 0.05% LMNG, or 0.5% CHAPS)

• Incorporate stabilizing agents such as glycerol (5-10%) or specific lipids

• Perform reconstitution at 4°C with gentle mixing (avoid vortexing)

• Allow complete hydration (30-60 minutes) before experimental use

• Filter through a 0.22 μm filter if absolute sterility is required

After reconstitution, the protein should be used immediately for optimal results or appropriately stored with glycerol as described in the previous question.

What experimental approaches can be used to study RHA1_ro06609 membrane integration and topology?

Investigating the membrane integration and topology of RHA1_ro06609 requires specialized techniques that probe both structure and orientation. Several complementary methodological approaches are recommended:

Biochemical Methods:

• Protease protection assays: Exposing membrane vesicles containing the protein to proteases will cleave only exposed regions, allowing identification of transmembrane domains

• Chemical labeling: Using membrane-impermeable reagents to label accessible amino acids (typically cysteines) to determine which regions face which side of the membrane

• Glycosylation mapping: Engineering glycosylation sites throughout the protein to determine lumenal exposure

Biophysical Methods:

• Fluorescence resonance energy transfer (FRET): To measure distances between specific domains

• Electron paramagnetic resonance (EPR) spectroscopy: Using site-directed spin labeling to determine the environment of specific residues

• Hydrogen-deuterium exchange mass spectrometry: To identify regions with differential solvent accessibility

Computational Approaches:

• Hydropathy analysis: Using algorithms like Kyte-Doolittle to predict transmembrane regions

• Comparative modeling: Based on homologous proteins with known structures

• Molecular dynamics simulations: To model protein-membrane interactions

When designing these experiments, it's crucial to consider the native lipid environment of Rhodococcus sp. membranes, which may differ substantially from model systems. Incorporating native-like lipid compositions or nanodiscs can provide more physiologically relevant insights into RHA1_ro06609 topology.

How can RHA1_ro06609 be functionally characterized to determine its role in Rhodococcus sp.?

Functional characterization of RHA1_ro06609 presents unique challenges due to its uncharacterized nature (UPF0060 family). A systematic multi-dimensional approach is recommended:

Genetic Approaches:

• Knockout/knockdown studies: Generate deletion mutants in Rhodococcus sp. and assess phenotypic changes

• Complementation assays: Reintroduce the wild-type or mutated gene to confirm phenotype rescue

• Overexpression effects: Analyze consequences of protein overexpression on cell physiology

Biochemical Characterization:

• Binding partner identification: Use pull-down assays, co-immunoprecipitation, or proximity labeling (BioID)

• Transport assays: If suspected to be a transporter, measure substrate movement across membranes

• Enzymatic activity assays: Test for potential catalytic functions using various substrates

Structural Biology Integration:

• Cryo-electron microscopy: For high-resolution structural information

• X-ray crystallography: If the protein can be crystallized

• NMR spectroscopy: For dynamic information on smaller domains

Systems Biology Context:

• Transcriptomics: Identify co-regulated genes under various conditions

• Metabolomics: Profile metabolic changes in knockout mutants

• Interactomics: Map the protein interaction network

When undertaking functional studies, it's important to consider the native environment of Rhodococcus sp., particularly its adaptation to various ecological niches. The RHA1_ro06609 protein may have functions related to specific substrates or conditions encountered by these bacteria, such as xenobiotic degradation capabilities, membrane integrity maintenance, or stress response mechanisms.

What approaches can resolve challenges in obtaining high purity RHA1_ro06609 for structural studies?

Obtaining highly pure RHA1_ro06609 for structural studies requires addressing several membrane protein-specific challenges:

Advanced Purification Strategy:

Quality Control Checkpoints:

• SEC-MALS: To verify monodispersity and molecular weight

• Thermal stability assays: Using differential scanning fluorimetry

• Negative stain EM: To visually inspect protein homogeneity

• Mass spectrometry: For exact mass determination and post-translational modifications

Stability Enhancement Methods:

• Lipid supplementation: Adding specific lipids that stabilize the protein

• Nanodiscs or SMALPs: Incorporating the protein into more native-like membrane environments

• Ligand addition: If ligands are known, their addition often enhances stability

• Antibody fragments: Fab or nanobody co-purification to stabilize flexible regions

When moving toward structural studies, it's essential to carefully monitor the functional integrity of the purified RHA1_ro06609. Activity assays or binding studies should be performed at each purification step to ensure that the final product remains in its native conformation and hasn't been compromised during extraction from the membrane.

How can RHA1_ro06609 be incorporated into artificial membrane systems for functional studies?

Incorporating RHA1_ro06609 into artificial membrane systems requires careful consideration of the protein's native environment while leveraging synthetic biology approaches:

Liposome Reconstitution:

• Protocol optimization: Start with a 50:1 to 200:1 lipid:protein ratio

• Detergent removal methods: Compare dialysis, Bio-Beads, and gel filtration for efficiency

• Liposome size control: Extrusion through defined pore size membranes (100-400 nm)

• Asymmetric reconstitution: Consider techniques to maintain native orientation

Advanced Membrane Mimetics:

Functional Validation Methods:

• Proteoliposome permeability assays: Using fluorescent dyes to track potential transport

• Patch-clamp electrophysiology: If ion channel activity is suspected

• Solid-supported membrane electrophysiology: For charge movement detection

• Surface plasmon resonance: To measure interactions with potential binding partners

Methodological Considerations:

• Lipid composition: Start with E. coli polar lipids and gradually transition to compositions mimicking Rhodococcus membranes

• Buffer optimization: Screen different pH values and salt concentrations

• Temperature effects: Rhodococcus species grow at varying temperatures; test functional activity across a relevant range

• Orientation control: Use techniques like pH gradients during reconstitution to promote uniform orientation

This systematic approach allows for controlled investigation of RHA1_ro06609 function while minimizing artifacts from non-native conditions.

How can comparative genomics inform functional hypotheses about RHA1_ro06609?

Comparative genomics provides powerful insights into RHA1_ro06609 function by examining evolutionary patterns across species. A systematic analysis approach includes:

Homology Analysis:

• Sequence conservation mapping: Identify highly conserved residues likely essential for function

• Phylogenetic profiling: Determine co-occurrence patterns with other genes to suggest functional associations

• Domain architecture analysis: Compare domain organization with functionally characterized proteins

Genomic Context Examination:

Evolutionary Rate Analysis:

• Selection pressure calculation: Determine dN/dS ratios to identify constrained regions

• Lineage-specific adaptations: Identify Rhodococcus-specific sequence features

• Horizontal gene transfer assessment: Determine if RHA1_ro06609 was acquired horizontally

When interpreting comparative genomics data, it's essential to consider the ecological and metabolic context of Rhodococcus species, which are known for their diverse metabolic capabilities and adaptation to various environments. The UPF0060 family's conservation pattern across bacteria suggests a fundamental cellular role, possibly in membrane organization, small molecule transport, or signaling.

What are the optimal experimental controls when studying RHA1_ro06609 in vitro and in vivo?

Designing appropriate controls is critical for rigorous research on RHA1_ro06609. A comprehensive control strategy includes:

In Vitro Experimental Controls:

• Protein-specific controls:

  • Heat-denatured RHA1_ro06609 (negative control)

  • Site-directed mutants of conserved residues (specificity controls)

  • Tag-only protein preparation (tag interference control)

  • Non-membrane protein with similar size/properties (non-specific effect control)

• Environment controls:

  • Empty liposomes/nanodiscs (membrane effect control)

  • Varying lipid compositions (membrane dependency control)

  • Buffer-only reactions (background control)

In Vivo Experimental Controls:

• Genetic controls:

  • Empty vector transformants (vector effect control)

  • Complemented knockout strains (specificity verification)

  • Point mutant complementation (structure-function validation)

  • Heterologous expression in distinct bacterial species (host factor detection)

• Expression controls:

  • Inducible promoter systems with titrated expression levels

  • Fluorescent protein fusions to confirm localization

  • Western blotting for expression level normalization

  • RT-qPCR for transcript level verification

Validation Approach Matrix:

When designing controls, consider the modular nature of membrane proteins and the potential for domain-specific functions. Including controls that address each functional domain separately can provide more precise insights into RHA1_ro06609's role.

How can advanced imaging techniques be applied to study RHA1_ro06609 localization and dynamics?

Advanced imaging techniques offer powerful approaches for investigating the cellular behavior of RHA1_ro06609:

Super-Resolution Microscopy Applications:

• Localization patterns:

  • PALM/STORM imaging of fluorophore-tagged RHA1_ro06609 to map nanoscale distribution

  • SIM microscopy for co-localization with other membrane components

  • STED microscopy for high-resolution membrane domain association

• Dynamic behavior:

  • Single-particle tracking to monitor diffusion and confinement patterns

  • spt-PALM for population-level dynamics analysis

  • FRAP (Fluorescence Recovery After Photobleaching) for mobility assessment

Live-Cell Imaging Strategies:

Correlative Microscopy Approaches:

• CLEM (Correlative Light and Electron Microscopy): Combining fluorescence localization with ultrastructural context

• Cryo-CLEM: Preserving native structures through vitrification

• FIB-SEM (Focused Ion Beam-Scanning Electron Microscopy): For 3D ultrastructural context

Methodological Implementation:

• Develop functional fluorescent protein fusions (preferably with linkers to minimize interference)

• Validate fusion protein functionality through complementation assays

• Optimize expression levels to avoid artifacts from overexpression

• Implement inducible or native promoter systems for physiological expression levels

• Use membrane markers to provide contextual information

These advanced imaging approaches can reveal crucial information about RHA1_ro06609's distribution patterns, dynamics, and potential interaction partners, providing spatial context to biochemical data.

What strategies can address expression and solubility challenges when working with RHA1_ro06609?

Membrane proteins like RHA1_ro06609 present significant expression and solubility challenges. A systematic troubleshooting approach includes:

Expression Optimization Matrix:

Solubilization Strategy Optimization:

• Detergent screening protocol:

  • Start with mild detergents (DDM, LMNG, CHAPS)

  • Test detergent mixtures (e.g., DDM+CHS)

  • Evaluate novel amphipols and nanodiscs for downstream applications

• Extraction condition optimization:

  • Test buffer compositions (pH 6.0-8.5, salt concentration 100-500 mM)

  • Evaluate solubilization time (2-24 hours)

  • Optimize temperature during solubilization (4°C vs. room temperature)

Fusion Partner Approach:

• Solubility-enhancing tags: MBP, SUMO, or TrxA fusions

• Specialized membrane protein fusions: Mistic, HALO, or Dsb fusion systems

• Cleavable tags: TEV or PreScission protease sites for tag removal

Cell-Free Expression Systems:

• E. coli extract-based: With supplied lipids or detergents

• Insect cell extract: For eukaryotic folding machinery

• PURE system: For defined components and reduced proteolysis

When implementing these strategies, a parallel screening approach is recommended, testing multiple conditions simultaneously with small-scale expressions before scaling up. Maintaining consistent analytical methods (e.g., Western blotting, fluorescence-detection size-exclusion chromatography) across optimization experiments enables quantitative comparison of results.

How can researchers troubleshoot common issues when working with RHA1_ro06609?

Systematic troubleshooting approaches for common challenges with RHA1_ro06609:

Low Expression Yield Troubleshooting:

• Diagnostic steps:

  • Confirm plasmid sequence integrity

  • Verify mRNA expression via RT-PCR

  • Assess protein toxicity by monitoring growth curves

  • Test expression in multiple E. coli strains

• Remediation strategies:

  • Optimize codon usage for E. coli

  • Reduce expression temperature (16-20°C)

  • Use tight promoter control (pET/ara/rhamnose systems)

  • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

Protein Aggregation Solutions:

Functional Assay Troubleshooting:

• No detectable activity:

  • Verify protein integrity via limited proteolysis

  • Ensure native-like membrane environment

  • Test broader range of potential substrates/conditions

  • Examine requirement for co-factors or binding partners

• Inconsistent results:

  • Standardize protein:lipid ratios in reconstitution

  • Control for orientation in membrane systems

  • Implement internal standards for normalization

  • Verify homogeneity of proteoliposome preparations

Surface Analysis Challenges:

• Surface adsorption issues: Test different surface passivation methods

• Orientation control: Develop site-specific immobilization strategies

• Activity loss upon immobilization: Use longer linkers or cushioned surfaces

These troubleshooting approaches should be implemented methodically, changing one variable at a time while maintaining appropriate controls to identify the specific factors affecting RHA1_ro06609 behavior.

What bioinformatic tools and databases are most valuable for RHA1_ro06609 analysis?

Comprehensive bioinformatic analysis of RHA1_ro06609 requires multiple specialized tools:

Sequence Analysis Resources:

• Primary databases:

  • UniProt for curated protein information (Entry: Q0S254)

  • NCBI Protein database for comprehensive sequence data

  • Pfam for domain annotations

  • InterPro for integrated protein family analysis

• Specialized membrane protein tools:

  • TMHMM/TOPCONS for transmembrane helix prediction

  • SignalP for signal peptide identification

  • CCTOP for consensus topology prediction

  • MemProtMD for automated membrane protein MD simulations

Structural Prediction and Analysis:

Functional Inference Resources:

• Gene neighborhood visualization: MicrobesOnline, MGcV

• Co-expression analysis: STRING-db, COLOMBOS

• Metabolic context: KEGG, BioCyc for pathway integration

• Protein-protein interaction prediction: PSOPIA, STRING

Data Integration Platforms:

• Rhodococcus-specific resources: RhodoBase

• Bacterial membrane protein databases: MemProtDB, TCDB

• Structure visualization tools: PyMOL, ChimeraX with specialized membrane protein plugins

When applying these bioinformatic tools to RHA1_ro06609, it's important to consider the membrane environment when interpreting predictions. Many standard bioinformatic tools are optimized for soluble proteins and may require careful parameter adjustment for membrane proteins. Cross-validation using multiple tools is highly recommended, especially for topology predictions and functional inferences.

What are the most relevant experimental design considerations for studying protein-protein interactions involving RHA1_ro06609?

Investigating protein-protein interactions (PPIs) involving membrane proteins like RHA1_ro06609 requires specialized experimental designs:

In Vivo Interaction Detection Systems:

• Bacterial two-hybrid adaptations:

  • BACTH system optimized for membrane proteins

  • Split-ubiquitin assays adapted for prokaryotic systems

  • Proximity-based protein complementation assays (PCA)

• In situ labeling approaches:

  • BioID or TurboID proximity labeling

  • Photo-crosslinking with genetically encoded unnatural amino acids

  • APEX2-based proximity biotinylation

In Vitro Interaction Characterization:

Experimental Design Considerations:

• Controls specific to membrane PPIs:

  • Detergent-only controls to identify detergent-mediated interactions

  • Competition assays with excess unlabeled protein

  • Topology-specific mutations that shouldn't affect interactions

  • Heterologous expression systems to identify host-specific effects

• Buffer optimization:

  • Screen detergent types and concentrations

  • Test lipid supplementation effects

  • Optimize ionic strength and pH

  • Evaluate divalent cation requirements

• Validation hierarchy:

  • Primary screening using high-throughput methods

  • Secondary validation with orthogonal techniques

  • Tertiary confirmation in native or near-native systems

  • Functional validation of interaction significance

When designing these experiments, consider the potential for both specific (direct) interactions and non-specific membrane-mediated co-localization. Techniques that distinguish between these possibilities, such as FRET efficiency analysis or competitive binding assays, are particularly valuable for membrane protein interaction studies.

How can researchers integrate structural and functional data to develop comprehensive models of RHA1_ro06609 activity?

Developing a comprehensive understanding of RHA1_ro06609 requires integration of multiple data types:

Data Integration Framework:

• Structural data correlation:

  • Map conserved residues onto structural models

  • Identify potential functional sites through cavity analysis

  • Correlate dynamics from MD simulations with functional states

  • Use evolutionary coupling analysis to identify co-evolving residues

• Functional mapping approaches:

  • Alanine scanning mutagenesis of key residues

  • Creation of chimeric proteins with homologs

  • Domain swapping experiments

  • Cysteine accessibility scanning

Integrated Computational Modeling:

Visualization and Model Building:

• Structural visualization tools:

  • PyMOL with specialized membrane protein scripts

  • VMD with membrane visualization plugins

  • ChimeraX with multi-scale visualization capabilities

• Model validation approaches:

  • Cross-validation using data not used in model building

  • Prospective experimental testing of model predictions

  • Sensitivity analysis to parameter variations

  • Comparison with related proteins of known function

Data Sharing and Collaboration:

• Repository deposition:

  • PDB for structural data

  • BMRB for NMR data

  • EMDB for electron microscopy data

  • Zenodo or similar platforms for integrated datasets

• Collaborative tools:

  • Jupyter notebooks for reproducible analysis

  • GitHub for version control of analysis scripts

  • Interactive visualization tools for communication

The integration process should be iterative, with each round of data collection informing more targeted experiments. For RHA1_ro06609, which belongs to an uncharacterized protein family (UPF0060), this integrated approach is particularly valuable as it can leverage sparse data from multiple sources to develop testable hypotheses about function.

What are the most promising future research directions for understanding RHA1_ro06609 function?

Several high-potential research avenues could significantly advance our understanding of RHA1_ro06609:

Emerging Technologies Application:

• Cryo-electron tomography:

  • Visualize RHA1_ro06609 in its native membrane environment

  • Map distribution and organization within the bacterial membrane

  • Identify native interaction partners in situ

• Single-molecule approaches:

  • FRET-based conformational change detection

  • Optical tweezers for mechanical property analysis

  • Nanopore-based electrical measurements for transport function

Functional Genomics Strategies:

Evolutionary and Comparative Approaches:

• Ancient protein reconstruction:

  • Resurrect ancestral forms of RHA1_ro06609

  • Trace functional evolution through bacterial lineages

  • Identify core conserved functions versus specialized adaptations

• Metagenomic functional analysis:

  • Survey environmental distribution and variants

  • Correlate genetic variations with ecological niches

  • Identify specialized functions in different bacterial communities

Translational Research Potential:

• Biotechnological applications:

  • Engineered variants for specialized membrane functions

  • Biosensor development based on binding properties

  • Potential bioremediation applications if linked to Rhodococcus metabolic capabilities

• Structural biology platform:

  • Use as a model system for membrane protein methodology development

  • Test innovative crystallization or NMR approaches

  • Develop improved reconstitution systems

These future directions would benefit from interdisciplinary collaborations bringing together structural biologists, microbiologists, computational biologists, and synthetic biologists to address the multi-faceted nature of membrane protein function in bacterial systems.

How can researchers develop standardized protocols for RHA1_ro06609 to improve reproducibility across laboratories?

Standardization is critical for reproducible membrane protein research. For RHA1_ro06609, the following approaches are recommended:

Expression and Purification Standardization:

• Detailed protocol development:

  • Step-by-step procedures with critical parameter ranges

  • Benchmark quality control metrics at each stage

  • Troubleshooting decision trees for common issues

• Reference standards creation:

  • Production of standard protein batches for inter-lab calibration

  • Defined quality control spectra (CD, fluorescence, NMR fingerprints)

  • Activity benchmarks for functional assays

Methodological Standardization Matrix:

Reporting Standards Implementation:

• Minimum information guidelines:

  • Development of "Minimum Information About a Membrane Protein Experiment" (MIAMPE)

  • Standardized reporting templates for methods sections

  • Required metadata for database submissions

• Protocol repositories:

  • Detailed protocols in repositories like Protocols.io

  • Video protocols demonstrating critical techniques

  • Regular community-driven protocol updates

Collaborative Validation Frameworks:

• Multi-laboratory studies:

  • Ring trials testing protocol robustness across different labs

  • Identification of critical variables affecting reproducibility

  • Continuous refinement based on collaborative data

• Training standardization:

  • Development of training videos and materials

  • Hands-on workshops for standardized techniques

  • Certification processes for core techniques

Implementing these standardization approaches would significantly enhance research reproducibility for RHA1_ro06609 and potentially serve as a model for other membrane protein studies in the broader scientific community.

Comprehensive Properties of Recombinant Rhodococcus sp. UPF0060 membrane protein RHA1_ro06609

Comparative Analysis of RHA1_ro06609 Homologs Across Bacterial Species