Recombinant Rhodoferax ferrireducens ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Rhodoferax ferrireducens Physiology

  • Electron Transport Chain Integration: AtpB is essential for coupling proton gradients to ATP synthesis during anaerobic respiration. R. ferrireducens utilizes diverse electron acceptors, including Fe(III), which requires efficient ATP synthase activity for energy conservation .

  • Metabolic Adaptations: Genome analysis reveals R. ferrireducens lacks fermentative pathways for sugars, making ATP synthase vital for oxidative phosphorylation during organotrophic growth .

Bioelectricity Production

Recombinant AtpB has been studied in bioelectrochemical systems. Modifications to ATP synthase activity (e.g., overexpression or deletion) can enhance electron flux in microbial fuel cells. For example:

  • Engineered Geobacter sulfurreducens strains with modified ATPase subunits showed a threefold increase in iron reduction rates, highlighting the potential of ATP synthase manipulation for bioenergy applications .

Enzyme Engineering

  • Futile Cycle Creation: Introducing ATP-consuming pathways (e.g., exogenous ATPase expression) forces microbes to increase respiratory chain activity, improving electron transfer efficiency .

  • Substrate Utilization: AtpB variants could optimize ATP yield in engineered strains utilizing non-traditional substrates like glycerol or citrate .

Comparative Genomic Insights

  • The R. ferrireducens genome (4.7 Mb chromosome, 257 kb plasmid) encodes 4,451 CDSs, with ATP synthase genes conserved among Betaproteobacteria .

  • Unlike related species, R. ferrireducens cannot grow photosynthetically, relying entirely on respiratory ATP synthesis .

Synthetic Co-Culture Studies

  • Co-cultures of R. ferrireducens with methanogens (e.g., Methanosarcina barkeri) demonstrated interspecies electron transfer, where ATP synthase activity influenced carbon and electron flux .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade recombinant AtpB, necessitating optimized storage protocols .

  • Structural Resolution: High-resolution cryo-EM studies are needed to map proton translocation pathways in this subunit.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of this product is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its inclusion in development.
Synonyms
atpB; Rfer_1165; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) (Albidiferax ferrireducens)
Target Names
atpB
Target Protein Sequence
MRLSPDEIIFWQHGFLKLNATIVFTWGLMLVLAVGSKLITRKLSTGLKRSRWQNLLEIVV TAIEKQIEEVGLRDPKKYLGFLGTLFLFVATASLCTVIPGYEPPTGSLSTTAALAFCVFV AVPFFGIKDQGLGGYLKSYVEPTVIMLPFNIISEISRTLALAVRLFGNMMSGAMIIGILL TITPFIFPIVMTALGLLTGMVQAYIFSILAAVYIAAATRGRKPKPEPGEKH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in facilitating the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpB) in Rhodoferax ferrireducens?

ATP synthase subunit a (atpB) is a critical component of the F0 sector of ATP synthase in Rhodoferax ferrireducens. Based on homologous systems in other bacteria, atpB forms part of the membrane-embedded portion responsible for proton translocation across the cell membrane. This subunit contains the essential half-channels that facilitate proton movement, creating the proton gradient necessary for ATP synthesis by the catalytic F1 sector containing the alpha, beta, gamma, delta and epsilon subunits .

In Rhodoferax ferrireducens, which can grow under both aerobic and anaerobic conditions with various electron acceptors including Fe(III), Mn(IV), nitrate, fumarate, and oxygen, the ATP synthase plays a crucial role in energy conservation across these diverse metabolic states .

How is the atpB gene organized in the Rhodoferax ferrireducens genome relative to other ATP synthase components?

While specific genomic organization of ATP synthase genes in Rhodoferax ferrireducens is not fully characterized in the available literature, we can draw inferences from related bacterial systems. In photosynthetic bacteria like Rhodobacter capsulatus, the ATP synthase genes are organized into two separate operons: one for the F1 sector (atpHAGDC) and another for the F0 sector, which includes atpB .

The F1 operon in Rhodobacter capsulatus contains five genes coding for the extrinsic sector of ATP synthase, while the F0 operon contains genes for the membrane-embedded components . This separation of F0 and F1 genes into distinct operons appears to be common in photosynthetic bacteria, contrasting with the single-operon organization found in many other bacteria. Given the phylogenetic relationships between these bacterial species, a similar organization might exist in Rhodoferax ferrireducens, but genomic analysis would be required for confirmation.

What expression systems are most effective for producing recombinant Rhodoferax ferrireducens atpB?

For recombinant expression of membrane proteins like atpB from Rhodoferax ferrireducens, several expression systems may be considered:

  • Yeast expression systems: Evidence suggests yeast has been successfully used for production of other ATP synthase subunits from Rhodoferax ferrireducens, such as the delta subunit (atpH) .

  • E. coli-based systems: Modified strains like C41(DE3) and C43(DE3), specifically designed for membrane protein expression, may overcome toxicity issues often encountered with membrane proteins.

  • Cell-free expression systems: These can be useful for difficult-to-express membrane proteins, allowing direct incorporation into supplied liposomes or nanodiscs.

Methodological considerations for optimizing expression include:

  • Temperature modulation (particularly relevant for a psychrotolerant organism)

  • Codon optimization for the host system

  • Fusion tags to enhance solubility and facilitate purification

  • Induction strategy optimization

  • Supplementation with additional lipids or chaperones

Researchers should conduct small-scale expression trials with various systems to determine optimal conditions before scaling up production.

What purification strategies yield highest purity and stability for recombinant Rhodoferax ferrireducens atpB?

Purification of membrane proteins like atpB requires specialized approaches:

Recommended protocol:

  • Membrane isolation via differential centrifugation

  • Solubilization screening (test multiple detergents: DDM, LDAO, LMNG)

  • Affinity chromatography utilizing fusion tags

  • Size exclusion chromatography for final purification

  • Quality assessment via SDS-PAGE (target >85% purity, as achieved with other R. ferrireducens ATP synthase subunits)

Critical factors affecting purification outcomes:

  • Detergent selection significantly impacts both yield and functional integrity

  • Buffer composition should maintain pH between 6.7-7.1, reflecting R. ferrireducens' optimal growth range

  • Temperature control throughout purification (4-10°C recommended given the psychrotolerant nature of the source organism)

  • Addition of stabilizing agents (glycerol, specific lipids) may enhance stability

For structural studies, detergent exchange to amphipols or reconstitution into nanodiscs may improve stability and homogeneity.

How do the physiological characteristics of Rhodoferax ferrireducens influence its ATP synthase structure and function?

Rhodoferax ferrireducens displays several distinctive physiological characteristics that likely influence its ATP synthase components, including atpB:

Psychrotolerance adaptations:

  • Growth temperature range of 4-30°C with optimal growth at 25°C

  • Potential structural modifications in ATP synthase components to maintain flexibility and function at low temperatures

  • Possible alterations in membrane lipid composition affecting ATP synthase environment

Metabolic versatility influence:

  • Capability to use multiple electron acceptors (Fe(III), Mn(IV), nitrate, fumarate, oxygen)

  • Utilization of various electron donors (acetate, lactate, malate, propionate, pyruvate, succinate, benzoate)

  • Potential regulatory mechanisms to modulate ATP synthase activity under different energetic conditions

Research methodologies to investigate these relationships:

  • Comparative growth and ATP synthesis rates across temperature ranges

  • Lipid profiling of membranes at different growth temperatures

  • Activity assays under varying conditions mimicking environmental parameters

  • Thermal stability assessments of isolated ATP synthase components

These physiological characteristics may confer unique properties to R. ferrireducens ATP synthase that distinguish it from mesophilic counterparts.

What structural features distinguish Rhodoferax ferrireducens atpB from other bacterial homologs?

While specific structural data for R. ferrireducens atpB is limited in the available literature, several distinguishing features can be hypothesized based on its unique ecological niche:

Predicted cold-adaptive structural features:

  • Modified hydrophobic core packing for maintained flexibility at low temperatures

  • Potentially reduced proline content in key regions to enhance conformational adaptability

  • Altered surface charge distribution to optimize protein-solvent interactions in cold environments

Comparative structural analysis approach:

  • Sequence alignment with well-characterized bacterial atpB proteins

  • Identification of conserved functional regions versus divergent domains

  • Homology modeling using resolved structures as templates

  • Molecular dynamics simulations at varying temperatures (4°C, 25°C, 37°C)

  • Validation of structural predictions through mutagenesis studies

Regions of interest would include transmembrane domains, proton-conducting channels, and interaction sites with other F0 subunits, where adaptations specific to R. ferrireducens' lifestyle might be most pronounced.

What methods are effective for assessing the activity of recombinant Rhodoferax ferrireducens atpB?

Assessing atpB function presents unique challenges as it functions as part of the larger ATP synthase complex. Several complementary approaches can be employed:

Proton translocation assessment:

  • Reconstitution of purified atpB into liposomes containing pH-sensitive fluorescent dyes

  • Measurement of proton flux using a pH electrode system

  • Patch-clamp electrophysiology for direct measurement of proton conductance

Complex assembly verification:

  • Co-reconstitution with other F0 components followed by blue native PAGE

  • Crosslinking studies to confirm proper subunit interactions

  • Pull-down assays with other ATP synthase components

Functional complementation:

  • Expression of R. ferrireducens atpB in ATP synthase-deficient bacterial strains

  • Assessment of restoration of growth phenotypes

  • Comparison of complementation efficiency at different temperatures

Data interpretation considerations:

  • Activity should be evaluated across temperature ranges relevant to R. ferrireducens (4-30°C)

  • pH range should reflect the organism's natural environment (pH 6.7-7.1)

  • Controls with known inhibitors (e.g., DCCD) should be included to confirm specificity

How can site-directed mutagenesis be used to study the function of Rhodoferax ferrireducens atpB?

Site-directed mutagenesis represents a powerful approach for structure-function analysis of atpB:

Strategic mutagenesis targets:

  • Conserved residues in predicted proton channels

  • Putative intersubunit interaction sites

  • Residues unique to R. ferrireducens compared to mesophilic bacteria

  • Amino acids hypothesized to contribute to cold adaptation

Methodological workflow:

  • Design primers for mutagenesis based on sequence analysis and homology modeling

  • Generate mutant constructs using standard molecular biology techniques

  • Express and purify mutant proteins following established protocols

  • Assess effects on:

    • Protein stability (thermal shift assays, circular dichroism)

    • Proton translocation (liposome reconstitution assays)

    • Complex assembly (interaction studies with other subunits)

    • Functional complementation (in vivo rescue experiments)

Advanced mutagenesis approaches:

  • Cysteine scanning mutagenesis combined with accessibility studies

  • Introduction of fluorescent amino acid analogs at key positions

  • Charge-swapping mutations to confirm electrostatic interactions

This systematic approach would generate a comprehensive functional map of R. ferrireducens atpB and identify unique features related to its ecological adaptations.

What challenges arise in crystallizing recombinant Rhodoferax ferrireducens atpB for structural studies?

Crystallization of membrane proteins like atpB presents numerous challenges:

Technical obstacles:

  • Detergent micelle heterogeneity affecting crystal packing

  • Conformational flexibility inherent to dynamic membrane proteins

  • Limited hydrophilic surfaces for crystal contact formation

  • Potential instability during concentration processes

Methodological strategies:

  • Screening multiple detergents and lipid additives systematically

  • Utilization of lipidic cubic phase (LCP) crystallization techniques

  • Implementation of antibody fragment co-crystallization to increase hydrophilic surfaces

  • Consideration of crystallization at lower temperatures (10-15°C) to match native conditions

Alternative structural approaches:

  • Cryo-electron microscopy of reconstituted protein complexes

  • Solid-state NMR of reconstituted samples

  • Small-angle X-ray scattering for low-resolution envelope determination

  • Hydrogen-deuterium exchange mass spectrometry for dynamics information

The integration of multiple structural approaches would likely yield the most comprehensive understanding of R. ferrireducens atpB structure.

How does the function of atpB in Rhodoferax ferrireducens compare between aerobic and Fe(III)-reducing conditions?

R. ferrireducens can utilize multiple electron acceptors including oxygen and Fe(III) , potentially affecting ATP synthase function:

Bioenergetic considerations:

  • Different electron transport chains may generate varying proton motive force magnitudes

  • The direction of ATP synthase operation (synthesis vs. hydrolysis) may vary with metabolic state

  • Regulatory mechanisms may modify ATP synthase activity based on energetic demands

Experimental design for comparative studies:

  • Grow R. ferrireducens under aerobic vs. Fe(III)-reducing conditions

  • Isolate membrane vesicles from both growth conditions

  • Measure ATP synthesis/hydrolysis rates and proton translocation efficiency

  • Quantify ATP synthase complex composition and abundance via proteomics

  • Assess post-translational modifications that might regulate activity

Expected differences:

  • Potential alterations in ATP synthase assembly or subunit stoichiometry

  • Differences in ATP synthase abundance or localization

  • Possible shifts in proton/ATP stoichiometry

  • Varying kinetic parameters reflecting adaptation to different bioenergetic landscapes

Understanding these differences would provide valuable insights into how R. ferrireducens modulates its energy conservation machinery across metabolic states.

What are the optimal conditions for storing recombinant Rhodoferax ferrireducens atpB?

Proper storage is critical for maintaining the structure and function of membrane proteins like atpB:

Storage recommendations table:

FormulationTemperatureExpected Shelf LifeAdditional Considerations
Liquid-80°C6 monthsAvoid freeze-thaw cycles
Lyophilized-20°C/-80°C12 monthsReconstitute carefully

Buffer composition considerations:

  • pH between 6.7-7.1 to match R. ferrireducens optimal growth range

  • 10-20% glycerol as cryoprotectant

  • Appropriate detergent at concentrations above CMC

  • Potential addition of specific lipids for stability

  • Reducing agents if cysteine residues are present

  • Protease inhibitors to prevent degradation

Quality control protocols:

  • Periodic SDS-PAGE analysis to monitor degradation

  • Functional assays to verify activity retention

  • SEC-MALS to assess oligomeric state stability

The specific formulation should be optimized experimentally, with storage in small aliquots to avoid repeated freeze-thaw cycles which should be strictly avoided .

How can ATP synthase activity be measured in crude membrane preparations from Rhodoferax ferrireducens?

Membrane-based assays offer advantages for studying ATP synthase in a near-native environment:

Membrane preparation protocol:

  • Harvest R. ferrireducens cells at mid-log phase

  • Disrupt cells via French press or sonication

  • Remove unbroken cells and debris via low-speed centrifugation

  • Collect membranes by ultracentrifugation (150,000 × g, 1 hour)

  • Resuspend membrane pellet in appropriate buffer

ATP synthesis activity measurement:

  • Energize membranes with artificial electron donors appropriate for R. ferrireducens

  • Provide ADP and inorganic phosphate

  • Quantify ATP production via luciferase assay or HPLC

  • Include appropriate controls (uncouplers, specific inhibitors)

ATP hydrolysis activity measurement:

  • Provide ATP to membrane preparations

  • Monitor phosphate release using colorimetric assays

  • Assess sensitivity to known inhibitors to confirm specificity

  • Measure activity across temperature range (4-30°C) relevant to R. ferrireducens

Data interpretation:

  • Calculate specific activity normalized to protein content

  • Determine temperature and pH optima

  • Compare kinetic parameters across growth conditions

  • Assess inhibitor sensitivity profiles

This approach allows measurement of ATP synthase activity in a membrane context before attempting more challenging reconstitution experiments.

What approaches can be used to study the assembly of complete ATP synthase complex using recombinant subunits from Rhodoferax ferrireducens?

Understanding ATP synthase assembly requires specialized techniques:

In vitro reconstitution strategy:

  • Express and purify individual subunits (including atpB)

  • Combine subunits under controlled conditions

  • Verify complex formation via:

    • Blue native PAGE

    • Analytical ultracentrifugation

    • Electron microscopy

    • Mass spectrometry under native conditions

Critical factors affecting successful reconstitution:

  • Order of subunit addition

  • Lipid composition of reconstitution environment

  • Buffer conditions (particularly important for psychrotolerant organisms)

  • Temperature control during assembly process

Analytical techniques for assembly intermediates:

  • Single-molecule FRET to monitor subunit interactions

  • Hydrogen-deuterium exchange mass spectrometry to track conformational changes

  • Chemical crosslinking followed by MS analysis to map interaction interfaces

  • Time-resolved cryo-EM to capture assembly intermediates

This systematic approach would provide unprecedented insights into the assembly pathway of R. ferrireducens ATP synthase and potentially reveal adaptations related to its unique ecological niche.

How can computational approaches aid in the structural characterization of Rhodoferax ferrireducens atpB?

Computational methods offer valuable complementary approaches to experimental structural biology:

Recommended computational workflow:

  • Homology modeling based on known bacterial atpB structures

  • Model refinement through molecular dynamics simulations

  • Validation via coevolutionary analysis (identifying correlated mutations)

  • Integration with sparse experimental data (crosslinking, spectroscopic measurements)

  • Protein-protein docking to model interactions with other ATP synthase subunits

Special considerations for R. ferrireducens atpB:

  • Simulation across temperature range (4-30°C) to investigate thermal adaptations

  • Incorporation of appropriate lipid environment mimicking psychrotolerant bacteria

  • Comparison with mesophilic homologs to identify unique structural features

Applications of computational models:

  • Generation of testable hypotheses for mutagenesis studies

  • Identification of potential binding sites for inhibitors or regulators

  • Prediction of conformational changes during proton translocation

  • Understanding of temperature-dependent structural dynamics

These computational approaches are particularly valuable for membrane proteins like atpB where experimental structural determination remains challenging.

What are the challenges in expressing and purifying functional recombinant Rhodoferax ferrireducens atpB?

Membrane proteins present numerous expression and purification challenges:

Expression challenges:

  • Toxicity to host cells due to membrane integration

  • Protein misfolding or aggregation

  • Low expression yields

  • Potential requirement for specific chaperones

Purification obstacles:

  • Selection of appropriate detergents for extraction

  • Maintaining native conformation during solubilization

  • Removing lipids without destabilizing protein

  • Preventing aggregation during concentration

Methodological solutions:

  • Screen multiple expression systems (bacterial, yeast, insect, mammalian)

  • Optimize growth temperature (considering R. ferrireducens is psychrotolerant)

  • Evaluate various solubilization conditions systematically

  • Consider fusion partners to enhance expression and solubility

  • Implement quality control at each purification step

  • Develop functional assays to verify activity preservation

Success indicators:

  • Achieving purity >85% by SDS-PAGE analysis

  • Monodisperse peak by size exclusion chromatography

  • Retention of secondary structure verified by circular dichroism

  • Demonstration of functional activity in reconstituted systems

By addressing these challenges systematically, researchers can obtain functional recombinant R. ferrireducens atpB suitable for downstream structural and functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.