Recombinant Rhodoferax ferrireducens Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

PlsY operates in a two-step pathway:

  1. Acyl-phosphate formation: Acyl-acyl carrier protein is converted to acyl-phosphate by PlsX.

  2. Acyl transfer: PlsY transfers the acyl group to glycerol-3-phosphate, forming lysophosphatidic acid .

Substrate Specificity:

  • Electron donors: Acetate, lactate, pyruvate, and benzoate .

  • Inhibitors: Noncompetitive inhibition by palmitoyl-CoA (IC₅₀ not quantified) .

Metabolic Context:
In R. ferrireducens, PlsY supports anaerobic respiration using Fe(III), Mn(IV), or nitrate as electron acceptors . Unlike related species, R. ferrireducens lacks fermentative pathways, relying instead on complete oxidation of substrates via the TCA cycle .

Research Findings and Applications

Key Discoveries:

  • Thermotolerance: The enzyme remains active at 4–30°C, aligning with R. ferrireducens’ psychrotolerant nature .

  • Genetic Insights: The plsY gene (locus Rfer_2695) is part of a genomic cluster encoding lipid metabolism and transport proteins .

  • Biotechnological Potential:

    • Bioelectrochemical systems: R. ferrireducens’ ability to transfer electrons to electrodes suggests PlsY could play a role in microbial fuel cells .

    • Metabolic engineering: Modifying PlsY activity might enhance lipid production in industrial strains .

Comparative Analysis:

FeatureR. ferrireducens PlsYStreptococcus pneumoniae PlsY
Membrane Topology5 transmembrane domains 5 transmembrane domains
Temperature Range4–30°C Mesophilic (exact range unreported)
Inhibitor SensitivityPalmitoyl-CoA Not reported

Challenges and Future Directions

  • Structural resolution: No crystal structure is available; molecular dynamics studies are needed to clarify acyl-transfer mechanics.

  • Industrial scalability: Optimizing recombinant production in E. coli requires addressing discrepancies in protein length reports (207 vs. 224 residues) .

  • Ecological impact: Further studies could explore PlsY’s role in subsurface biogeochemical cycles, given R. ferrireducens’ prevalence in iron-rich environments .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. If you have a specific format requirement, kindly include it in your order remarks. We will then prepare the product according to your request.
Lead Time
The delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Rfer_2695; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) (Albidiferax ferrireducens)
Target Names
plsY
Target Protein Sequence
MRQQENFLESMQSFFPLAATLLGYLIGSLSFAVIVSRVMGLNDPRTFGSKNPGATNVLRS GSKTAAIVTLLLDAAKGWLPVMLVRWYGKPYGMEEGTMALVGLAAFIGHLYPVFFNFAGG KGVATALGVLLGLSPILALATGATWLIMAYFFRYVSLASLTAAVFVPVYYVFGDGMAWYL SKGVLAALCAMSLLLIYRHAENISRLIKGTESRLGKKARTERKS
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the metabolic role of Glycerol-3-phosphate acyltransferase (plsY) in Rhodoferax ferrireducens?

Glycerol-3-phosphate acyltransferase (plsY) catalyzes the first step in phospholipid biosynthesis by transferring an acyl group from acyl-ACP to glycerol-3-phosphate. In Rhodoferax ferrireducens, this enzyme is particularly important given the organism's metabolic versatility and ability to grow in diverse environmental conditions. R. ferrireducens possesses a full tricarboxylic acid (TCA) cycle and pentose phosphate pathway, indicating a complex metabolic network in which phospholipid biosynthesis plays a crucial role in cell membrane formation . The enzyme likely shows specific adaptations related to the organism's ability to function in anaerobic environments and its unique capability to transfer electrons to external acceptors.

What expression systems are most effective for producing recombinant R. ferrireducens plsY?

Based on general principles for expressing recombinant proteins from similar organisms, E. coli BL21(DE3) represents a suitable starting expression system for R. ferrireducens plsY. This approach has been successfully used for other enzymes from R. ferrireducens, as demonstrated in studies of related organisms . When establishing an expression system, consider the following methodological approach:

  • Codon optimization for the host organism

  • Addition of affinity tags (His6, GST, etc.) for purification

  • Testing multiple expression conditions (temperature, IPTG concentration, induction time)

  • Evaluating both cytoplasmic expression and periplasmic targeting

For difficult-to-express proteins, alternative expression systems such as Bacillus or yeast might be considered, particularly if post-translational modifications are required for activity.

What are the optimal assay conditions for measuring R. ferrireducens plsY enzymatic activity?

While specific conditions for R. ferrireducens plsY have not been fully characterized, insights from related enzymes suggest the following methodological approach:

  • Buffer composition: Test phosphate and Tris buffers in the pH range of 6.0-8.5

  • Temperature: Evaluate activity between 30-50°C, with special attention to 40°C (optimal for related enzymes)

  • Substrate concentrations: Titrate glycerol-3-phosphate (0.1-10 mM) and acyl-ACP (1-100 μM)

  • Reducing agents: Include dithiothreitol (1-5 mM) which may enhance activity by 15-20%

  • Potential cofactors: Test divalent cations (Mg²⁺, Mn²⁺, Ca²⁺), though related enzymes don't strictly require them

Activity can be measured using radioisotope-labeled substrates or by coupling the reaction to spectrophotometric assays that track either substrate consumption or product formation.

How can researchers overcome challenges in purifying active recombinant plsY from R. ferrireducens?

Purification of active membrane-associated enzymes like plsY presents several challenges. A successful purification strategy includes:

  • Membrane fraction isolation: Differential centrifugation following cell lysis

  • Detergent screening: Test a panel of detergents (DDM, CHAPS, Triton X-100) at various concentrations

  • Chromatography sequence:

    • IMAC (immobilized metal affinity chromatography) for His-tagged proteins

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography as a final polishing step

The following table summarizes potential detergents and their typical working concentrations:

DetergentCritical Micelle ConcentrationWorking Range for ExtractionWorking Range for Purification
DDM0.17 mM0.5-2%0.05-0.1%
CHAPS8-10 mM0.5-1.5%0.1-0.5%
Triton X-1000.2-0.9 mM1-2%0.1-0.2%

Activity assays should be performed at each purification step to track enzyme stability and identify conditions that preserve function.

What experimental design approaches are most effective for studying the structure-function relationship of R. ferrireducens plsY?

To investigate structure-function relationships, implement a multifaceted experimental approach:

  • Site-directed mutagenesis of conserved residues in the active site

  • Domain swapping with homologous enzymes from related organisms

  • Loop replacement strategy, which has proven successful for other enzymes

  • Truncation analysis to identify essential domains

For protein engineering experiments, follow established principles of experimental design including:

  • Randomization of test conditions to eliminate bias

  • Inclusion of appropriate controls (positive, negative, and wild-type references)

  • Replication of experiments to ensure statistical validity

When analyzing results, employ molecular dynamics simulations to understand how structural modifications affect enzyme flexibility and substrate binding, as demonstrated in studies of other enzymes .

How can researchers engineer R. ferrireducens plsY for enhanced stability or altered substrate specificity?

Engineering R. ferrireducens plsY for enhanced properties requires sophisticated approaches:

  • Rational design strategy:

    • Homology modeling based on crystal structures of related enzymes

    • Identification of residues involved in substrate binding or catalysis

    • Introduction of stabilizing interactions (salt bridges, disulfide bonds)

    • Modification of loop regions that influence substrate access

  • Directed evolution approach:

    • Error-prone PCR to generate variant libraries

    • DNA shuffling with homologous enzymes

    • Creation of site-saturation mutagenesis libraries targeting specific residues

    • High-throughput screening assays to identify improved variants

  • Semi-rational design combining both approaches:

    • Smart libraries focusing on hotspots identified through computational analysis

    • Iterative cycles of mutagenesis and screening

Importantly, validation of engineered variants should include comprehensive kinetic analysis, thermal stability measurements, and assessment of performance under conditions relevant to potential applications .

What insights can kinetic isotope effect studies provide about the catalytic mechanism of R. ferrireducens plsY?

Kinetic isotope effect (KIE) studies can reveal critical details about the catalytic mechanism of plsY:

  • Primary KIE experiments:

    • Synthesis of isotopically labeled substrates (²H, ¹³C, or ¹⁸O-labeled glycerol-3-phosphate)

    • Measurement of reaction rates with labeled and unlabeled substrates

    • Calculation of KIE values (kH/kD, k¹²C/k¹³C, or k¹⁶O/k¹⁸O)

  • Solvent isotope effect studies:

    • Performing reactions in H₂O vs. D₂O

    • Analysis of pH-rate profiles in both solvents

  • Data interpretation:

    • Large primary KIE values (>2) suggest that bond breaking/formation is rate-limiting

    • Multiple isotope effects can identify concerted vs. stepwise mechanisms

    • Temperature dependence of KIE values can reveal tunneling contributions

These approaches can help determine whether the acyl transfer proceeds via a direct displacement mechanism or through formation of a tetrahedral intermediate, information critical for rational enzyme engineering .

How does the structure of R. ferrireducens plsY adapt to the organism's unique electron transfer capabilities?

R. ferrireducens possesses remarkable electron transfer capabilities, including the ability to convert sugars to electricity with quantitative electron transfer to graphite electrodes . The plsY enzyme functions within this unique metabolic context, potentially with structural adaptations that accommodate these capabilities:

  • Investigate potential interactions between plsY and electron transport chain components:

    • Co-immunoprecipitation studies to identify protein-protein interactions

    • Crosslinking experiments followed by mass spectrometry

    • Two-hybrid screenings to map interaction networks

  • Examine membrane localization and potential associations with electron transfer complexes:

    • Membrane fractionation studies

    • Fluorescence microscopy with tagged plsY variants

    • Super-resolution microscopy techniques

  • Explore how phospholipid composition influenced by plsY activity affects membrane electron transfer:

    • Lipidomic analysis under different growth conditions

    • Correlation between phospholipid profiles and electron transfer efficiency

    • Reconstitution experiments with defined lipid compositions

Understanding these adaptations could provide insights into the evolutionary specialization of R. ferrireducens and potentially inform biomimetic approaches for enhanced electron transfer in synthetic systems .

How can researchers address data reproducibility challenges when working with recombinant membrane enzymes like R. ferrireducens plsY?

Ensuring reproducible data with membrane enzymes presents several challenges:

  • Standardization of enzyme preparation:

    • Document detailed protocols for membrane fraction isolation

    • Quantify both protein concentration and specific activity

    • Establish QC criteria for batch acceptance

    • Create reference standards for inter-lab comparisons

  • Controlling environmental variables:

    • Monitor and record temperature fluctuations during assays

    • Control oxygen levels, particularly important for organisms like R. ferrireducens with anaerobic capabilities

    • Standardize buffer components and substrate quality

  • Statistical approaches to strengthen data validity:

    • Implement randomized block designs to account for batch effects

    • Conduct power analyses to determine appropriate sample sizes

    • Use statistical process control charts to monitor assay performance over time

These methodological improvements address key research challenges in enzyme characterization, including participant recruitment and institutional buy-in for collaborative studies .

What techniques are most effective for studying the interaction between R. ferrireducens plsY and its native membrane environment?

The membrane context significantly influences plsY function. Several approaches can elucidate these interactions:

  • Native membrane studies:

    • Preparation of inverted membrane vesicles from R. ferrireducens

    • Activity assays in the native membrane context

    • EPR spectroscopy with spin-labeled lipids to measure membrane fluidity

  • Reconstitution approaches:

    • Systematic testing of different lipid compositions in proteoliposomes

    • Nanodiscs with controlled lipid environments

    • Solid-supported membrane systems for electrophysiological measurements

  • Advanced biophysical techniques:

    • Neutron reflectometry to determine protein orientation

    • ATR-FTIR spectroscopy to examine secondary structure in membrane environments

    • Fluorescence correlation spectroscopy to measure diffusion coefficients

These approaches help overcome the challenges of studying membrane proteins while preserving their native functional state, addressing one of the fundamental challenges in enzyme research .

How can multi-omics approaches enhance our understanding of R. ferrireducens plsY in the context of the organism's unique metabolism?

Integrating multiple omics technologies provides a systems-level understanding of plsY function:

  • Transcriptomics:

    • RNA-seq analysis under different growth conditions (aerobic vs. anaerobic, different electron acceptors)

    • Identification of co-regulated genes in the phospholipid biosynthesis pathway

    • Mapping of transcriptional responses to environmental changes

  • Proteomics:

    • Quantitative proteomic analysis of membrane fractions

    • Phosphoproteomics to identify regulatory modifications

    • Protein-protein interaction networks via proximity labeling approaches

  • Metabolomics:

    • Targeted analysis of phospholipid profiles

    • Flux analysis using ¹³C-labeled substrates

    • Correlation between metabolite levels and electron transfer efficiency

  • Integrative analysis:

    • Constraint-based modeling similar to approaches used for whole-genome metabolic reconstruction of R. ferrireducens

    • Machine learning approaches to identify patterns across multi-omics datasets

    • Pathway enrichment analysis to contextualize plsY within broader metabolic networks

This multi-layered approach addresses the complexity of R. ferrireducens metabolism, including its unique abilities to utilize various electron acceptors and carbon sources .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.