Recombinant Rhodoferax ferrireducens NADH-quinone oxidoreductase subunit A (nuoA)

What is Rhodoferax ferrireducens and what distinguishes it from other members of the Rhodoferax genus?

Rhodoferax ferrireducens is a psychrotolerant bacterium isolated from the mud of Oyster Bay in Virginia. Unlike other members of the Rhodoferax genus, R. ferrireducens is not phototrophic and cannot ferment fructose. It is metabolically versatile and plays important roles in carbon and metal cycles in subsurface environments .

Key distinguishing characteristics include:

R. ferrireducens has the unique ability to convert sugars to electricity through quantitative electron transfer to graphite electrodes in microbial fuel cells, making it particularly interesting for bioenergy research .

What is the function of NADH-quinone oxidoreductase in bacterial metabolism?

NADH-quinone oxidoreductase (Complex I) functions as a proton pump across bacterial plasma membranes, playing a crucial role in energy conservation and respiratory metabolism . This enzyme complex:

• Catalyzes the transfer of electrons from NADH to quinones in the respiratory chain

• Couples this electron transfer to proton translocation across the membrane

• Contributes to the generation of the proton motive force used for ATP synthesis

• Serves as the entry point for electrons into the respiratory chain in bacteria

In R. ferrireducens specifically, the NADH-quinone oxidoreductase complex is part of an electron transport chain with an H+/2e- ratio of 2 for the NADH dehydrogenase component and 2 for cytochrome reductase. This configuration differs from other Fe(III)-reducing bacteria like Geobacter sulfurreducens, suggesting that R. ferrireducens possesses a more efficient electron transport system .

What is known about the structure and topology of nuoA in bacterial systems?

NuoA is a small membrane-spanning subunit of respiratory chain NADH:quinone oxidoreductase (Complex I). Unlike other complex I core protein subunits, the NuoA protein has no known homologue in other enzyme systems . The structural features of nuoA include:

• Small polypeptide size (typically 147 amino acids in E. coli)

• Contains hydrophobic transmembrane regions

• The C-terminal end in E. coli is localized in the bacterial cytoplasm, contrary to earlier reports for homologous proteins in other bacteria

• The transmembrane orientation cannot be unambiguously predicted due to the small size of the polypeptide and varying distribution of charged amino acid residues in nuoA from different organisms

In E. coli, the amino acid sequence of nuoA (1-147) is: MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR . This sequence information can serve as a reference for comparative studies with R. ferrireducens nuoA.

How does the electron transport chain of R. ferrireducens compare to other Fe(III)-reducing bacteria, and what role might nuoA play in this process?

R. ferrireducens possesses a distinct electron transport chain compared to other Fe(III)-reducing bacteria like Geobacter sulfurreducens. Genome-scale metabolic modeling has revealed:

This difference suggests that R. ferrireducens has evolved a more efficient electron transport chain, which may explain its competitive advantage in certain environmental niches .

Methodologically, researchers can investigate nuoA's role in this system through:

• Site-directed mutagenesis targeting conserved residues in nuoA

• Membrane potential measurements in wild-type versus nuoA-modified strains

• Comparative proteomics of the membrane fraction under varying electron acceptor conditions

• Electron transfer kinetics studies using electrochemical techniques

The higher efficiency of R. ferrireducens may be particularly important in environments with low carbon availability, where R. ferrireducens has been shown to outcompete Geobacter species .

What approaches can be used to investigate the transmembrane topology of nuoA in R. ferrireducens?

Given the challenges in predicting nuoA topology through computational methods alone, experimental approaches are essential. Methodological strategies include:

• Fusion protein analysis: As demonstrated with E. coli nuoA, create fusion proteins with reporter enzymes like cytochrome c and alkaline phosphatase. The activity of these reporters in different cellular compartments can reveal the orientation of nuoA segments .

• Accessibility labeling: Use membrane-impermeable reagents that react with specific amino acid residues (typically cysteines) to determine which portions of the protein are exposed to the periplasm versus the cytoplasm.

• Protease protection assays: Treat membrane vesicles with proteases, then analyze which portions of nuoA are protected from digestion to determine their membrane orientation.

• Cysteine scanning mutagenesis: Systematically introduce cysteine residues throughout nuoA, then probe their accessibility with thiol-reactive reagents.

• Cryo-EM structural analysis: While challenging for individual subunits, this approach has been successful for the entire Complex I, as evidenced by structures like 6zjl, 6zjn, 6zjy for the TtNQO complex I .

These experimental methods should be combined with computational predictions based on hydrophobicity plots, charge distribution analysis, and evolutionary conservation patterns.

How can genomic and metabolic insights from R. ferrireducens be leveraged to understand nuoA function in electron transfer processes?

Understanding nuoA function requires integration of genomic, transcriptomic, and metabolic data. Research strategies include:

• Constraint-based metabolic modeling: Develop a genome-scale in silico metabolic model similar to that used for R. ferrireducens previously . This approach can predict the impact of nuoA mutations on electron flow and energy conservation.

• Comparative genomics: Analyze nuoA sequence conservation across related species with different electron transfer capabilities. The non-phototrophic nature of R. ferrireducens compared to other Rhodoferax species provides a natural experiment for understanding adaptive changes in electron transport components .

• Transcriptomics under varying electron acceptor conditions: Monitor nuoA expression levels when R. ferrireducens is grown with different electron acceptors (Fe(III), Mn(IV), oxygen, fumarate, nitrate) to understand its role in each respiratory pathway .

• Proteomics focused on protein-protein interactions: Identify binding partners of nuoA within the membrane domain of Complex I and potentially with other components of the electron transport chain.

This integrated approach can reveal how nuoA contributes to the metabolic versatility of R. ferrireducens, particularly its ability to utilize diverse electron acceptors and its unique capability for electricity generation in microbial fuel cells .

What expression systems are optimal for producing recombinant R. ferrireducens nuoA for structural and functional studies?

Producing functional recombinant nuoA presents significant challenges due to its membrane-associated nature. Recommended methodological approaches include:

• E. coli expression systems:

  • BL21(DE3) or C43(DE3) strains are specifically engineered for membrane protein expression

  • Consider using a construct with an N-terminal His-tag as demonstrated for E. coli nuoA

  • Expression at lower temperatures (16-20°C) may improve proper folding

  • Codon optimization for E. coli may be necessary if R. ferrireducens uses rare codons

• Homologous expression:

  • Expression in R. ferrireducens itself may preserve native folding and assembly

  • Requires development of genetic manipulation tools for this organism

  • Consider inducible promoter systems to control expression levels

• Cell-free expression systems:

  • Commercial systems supplemented with lipids or nanodiscs can facilitate membrane protein production

  • Allows incorporation of modified amino acids for structural studies

• Purification strategy:

  • Two-phase detergent extraction (mild detergents like DDM or LMNG)

  • Affinity chromatography using the His-tag

  • Size exclusion chromatography to obtain homogeneous protein preparations

  • Consider stability in various detergents or reconstitution into proteoliposomes

When evaluating expression, it's crucial to assess not just protein yield but also proper folding and function through activity assays targeting NADH oxidation capacity.

How can activity assays be designed to characterize the function of recombinant nuoA within the NADH:quinone oxidoreductase complex?

• NADH oxidation assays:

  • Spectrophotometric monitoring of NADH oxidation at 340 nm

  • Comparison between wild-type and nuoA-modified versions

  • Inclusion of appropriate electron acceptors (ubiquinone analogs like decyl-ubiquinone)

• Proton translocation measurements:

  • pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor ΔpH formation

  • Ion-selective electrodes to directly measure proton movement

  • Reconstitution of purified complex into proteoliposomes to create a closed system

• Electron paramagnetic resonance (EPR) spectroscopy:

  • Monitor redox states of Fe-S clusters in the electron transport chain

  • Identify changes in electron flow patterns when nuoA is modified

• Electrochemical approaches:

  • Protein film voltammetry to measure direct electron transfer to electrodes

  • Particularly relevant given R. ferrireducens' ability to transfer electrons to electrodes in microbial fuel cells

• Inhibitor studies:

  • Compare sensitivity to known Complex I inhibitors between wild-type and nuoA-modified versions

  • May reveal functional contributions of nuoA to the catalytic mechanism

These assays should be performed under conditions mimicking the natural growth environment of R. ferrireducens (pH 6.7-7.1, appropriate temperature range of 4-30°C with optimal activity likely around 25°C) .

What methodologies can be employed to investigate the role of nuoA in R. ferrireducens' unique ability to reduce Fe(III) and generate electricity?

R. ferrireducens' distinctive ability to reduce Fe(III) and generate electricity through electron transfer to electrodes warrants specialized experimental approaches to understand nuoA's role:

• Microbial fuel cell (MFC) experiments:

  • Compare electricity generation between wild-type and nuoA-modified strains

  • Analyze biofilm formation on electrodes using confocal microscopy

  • Conduct polarization curve analysis to determine power output differences

• Fe(III) reduction assays:

  • Quantify ferrous iron formation using the ferrozine assay

  • Monitor reduction rates with soluble [Fe(III)-NTA] and insoluble [Fe(III) oxide] forms

  • Correlate reduction rates with nuoA expression levels

• Transcriptomics during electrode respiration:

  • RNA-seq analysis comparing gene expression during growth with Fe(III) versus electrodes

  • Determine if nuoA is differentially regulated during these processes

• Membrane fraction analysis:

  • Isolate membrane fractions from cells grown with different electron acceptors

  • Quantify nuoA protein levels using targeted proteomics

  • Analyze protein-protein interactions using crosslinking and mass spectrometry

• In vivo electron transport imaging:

  • Fluorescent redox sensors to visualize electron flow in live cells

  • Compare patterns between wild-type and nuoA-modified strains

These methodologies should be implemented with appropriate controls, including comparison to other Rhodoferax species that lack Fe(III) reduction capabilities, to isolate the specific contribution of nuoA to these unique metabolic features .

How can bioinformatics approaches be applied to predict functional residues in R. ferrireducens nuoA?

Identifying functional residues in nuoA requires sophisticated bioinformatics approaches. Recommended methodological strategies include:

• Multiple sequence alignment (MSA) analysis:

  • Align nuoA sequences from diverse bacterial species, particularly comparing R. ferrireducens with other Rhodoferax species and known Fe(III)-reducers

  • Identify conserved residues across all species (likely essential for function)

  • Identify residues conserved only in Fe(III)-reducing bacteria (potentially specific to that function)

• Evolutionary trace analysis:

  • Correlate sequence conservation patterns with functional divergence

  • Identify positions that differ between phototrophic and non-phototrophic Rhodoferax species

• Structural prediction and modeling:

  • Generate homology models based on available structures of Complex I (references: 4hea, 3m9s, 6zjl, etc.)

  • Use AlphaFold or RoseTTAFold for ab initio modeling of nuoA structure

  • Map conserved residues onto structural models to identify functional clusters

• Molecular dynamics simulations:

  • Simulate nuoA behavior within a membrane environment

  • Analyze conformational changes that might be associated with electron transport

  • Identify potential proton pathways through the protein

• Coevolution analysis:

  • Identify residues that show correlated mutation patterns, suggesting functional coupling

  • Use methods like Direct Coupling Analysis (DCA) or Statistical Coupling Analysis (SCA)

These computational approaches should guide experimental designs, particularly for site-directed mutagenesis studies targeting the identified residues of interest.

What statistical approaches are appropriate for analyzing nuoA expression data under different growth conditions?

• Normalization strategies for qPCR and RNA-seq data:

  • Use multiple reference genes specifically validated for stability in R. ferrireducens

  • Apply normalization methods like RPKM/FPKM for RNA-seq or ΔΔCt for qPCR

  • Consider batch effects when experiments are performed across different days

• Statistical tests for differential expression:

  • ANOVA for comparing multiple conditions simultaneously

  • Post-hoc tests (Tukey's HSD, Bonferroni correction) for pairwise comparisons

  • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney U) if normality assumptions are violated

• Multivariate analysis approaches:

  • Principal Component Analysis (PCA) to visualize clustering of experimental conditions

  • Hierarchical clustering to identify conditions with similar expression patterns

  • Correlation analysis between nuoA expression and metabolic outputs (Fe(III) reduction rates, electricity generation)

• Time-series analysis for dynamic responses:

  • Growth-phase dependent expression patterns

  • Adaptation responses when switching between electron acceptors

  • Use functional data analysis or time-series specific statistical methods

When reporting results, include all relevant statistical parameters (test statistic, degrees of freedom, p-values) and clearly state the significance threshold. Consider multiple testing correction when analyzing expression of multiple genes simultaneously.

How can comparative genomics and proteomics be integrated to understand the evolution of nuoA in R. ferrireducens?

Understanding the evolutionary context of nuoA requires integration of genomic and proteomic data:

• Phylogenetic analysis:

  • Construct phylogenetic trees of nuoA across diverse bacterial species

  • Compare with organismal phylogeny to identify potential horizontal gene transfer events

  • Analyze selection pressure (dN/dS ratios) to identify positively selected regions

• Genome context analysis:

  • Examine the organization of genes surrounding nuoA in R. ferrireducens compared to other species

  • Identify conserved gene clusters that might indicate functional relationships

  • Compare with the seven other sequenced Rhodoferax genomes as of 2019

• Protein domain architecture analysis:

  • Identify domain fusion/fission events in the evolution of nuoA

  • Examine whether nuoA contains domains shared with other proteins in R. ferrireducens

• Co-expression network analysis:

  • Identify genes consistently co-expressed with nuoA across conditions

  • Compare these networks between R. ferrireducens and other species

  • Look for rewiring events that might explain functional differences

• Proteome-wide interaction mapping:

  • Use cross-linking mass spectrometry to identify nuoA interaction partners

  • Compare interaction networks across species to identify conserved and divergent interactions

This integrated approach can reveal how nuoA has evolved in R. ferrireducens to support its unique metabolic capabilities, particularly in relation to Fe(III) reduction and electricity generation that distinguish it from other members of the Rhodoferax genus .

What emerging technologies could advance our understanding of nuoA function in R. ferrireducens?

Several cutting-edge technologies show promise for elucidating nuoA function:

• Cryo-electron tomography:

  • Visualize the 3D organization of the respiratory chain in intact R. ferrireducens cells

  • Examine membrane organization during growth with different electron acceptors

  • Compare wild-type and nuoA-modified strains to identify structural changes

• Single-molecule tracking:

  • Monitor the dynamics of fluorescently labeled nuoA in living cells

  • Analyze diffusion patterns and potential clustering during electron transfer

  • Examine colocalization with other respiratory chain components

• CRISPR-based approaches:

  • Develop CRISPR interference (CRISPRi) systems for R. ferrireducens to enable tunable gene repression

  • Create nuoA variants with precise modifications to functional domains

  • Perform CRISPR screens to identify genetic interactions with nuoA

• Synthetic biology reconstructions:

  • Express minimal respiratory chains containing R. ferrireducens nuoA in heterologous hosts

  • Design synthetic electron transfer pathways to test nuoA function in isolation

  • Create chimeric proteins to identify functionally important regions

• In situ structural biology:

  • Apply techniques like DEER-EPR spectroscopy to measure distances between subunits in intact complexes

  • Use HDX-MS (hydrogen-deuterium exchange mass spectrometry) to identify conformational changes during catalysis

These technologies could overcome current limitations in studying membrane protein function and provide unprecedented insights into the molecular mechanisms of electron transfer through nuoA in R. ferrireducens.

How might research on R. ferrireducens nuoA contribute to applications in bioelectrochemical systems and bioremediation?

Research on R. ferrireducens nuoA has significant potential applications:

• Enhanced microbial fuel cells (MFCs):

  • Engineer nuoA variants with optimized electron transfer capabilities

  • Develop strains with increased power output for bioelectricity generation

  • Create synthetic consortia combining engineered R. ferrireducens with other electroactive organisms

• Bioremediation of metal-contaminated environments:

  • Utilize R. ferrireducens' ability to reduce Fe(III) and potentially other metals

  • Engineer strains with modified nuoA for enhanced metal reduction capabilities

  • Design bioreactors optimized for specific contaminated sites

• Biosensors for environmental monitoring:

  • Develop R. ferrireducens-based biosensors that generate electrical signals in response to specific compounds

  • Use nuoA as a component in synthetic electron transfer pathways that respond to environmental stimuli

• Carbon capture technologies:

  • Exploit R. ferrireducens' complete TCA cycle and ability to utilize various carbon sources

  • Engineer strains for enhanced carbon fixation coupled to electricity generation

  • Develop systems that convert waste carbon to valuable products or electricity

• Bioelectrosynthesis platforms:

  • Reverse the electron flow through nuoA to drive reductive biosynthesis

  • Create systems that use electrical current to produce valuable chemicals

  • Couple to renewable electricity sources for sustainable bioproduction

These applications would build on the fundamental understanding of nuoA's role in electron transfer and could contribute to addressing challenges in sustainable energy production and environmental remediation .

What are the key unresolved questions regarding the structure-function relationship of nuoA in NADH:quinone oxidoreductase?

Despite significant advances, several fundamental questions about nuoA remain unanswered:

• Precise role in proton translocation:

  • Does nuoA form part of the proton channel in Complex I?

  • Which specific residues are involved in proton movement?

  • How does the unique H+/2e- ratio in R. ferrireducens relate to nuoA structure?

• Interaction with other Complex I subunits:

  • Which regions of nuoA interface with other subunits?

  • How does assembly of the complex occur, and what role does nuoA play?

  • Are there R. ferrireducens-specific interactions not found in other bacteria?

• Conformational dynamics during catalysis:

  • Does nuoA undergo conformational changes during electron transfer?

  • How might such changes couple electron movement to proton translocation?

  • What is the temporal sequence of events during catalysis?

• Adaptation to different electron acceptors:

  • Does nuoA structure or expression change when cells use different electron acceptors?

  • How does the electron transport chain reconfigure when switching between aerobic and anaerobic respiration?

  • What molecular features enable R. ferrireducens to reduce Fe(III) while other Rhodoferax species cannot?

• Evolutionary trajectory:

  • How did nuoA evolve in R. ferrireducens compared to photosynthetic relatives?

  • What selective pressures shaped its unique properties?

  • Can we identify key mutations that enabled new metabolic capabilities?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and computational methods. The answers could provide insights not only into R. ferrireducens biology but also into the fundamental principles of energy conservation in respiratory chains .