Recombinant Rhodoferax ferrireducens NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; Rfer_1503; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) (Albidiferax ferrireducens)
Target Names
nuoK
Target Protein Sequence
MTLTLGHFLSLGAMLFALSVIGIFLNRKNLIVLLMAIELMLLAVNTNFVAFSYYLGDMHG QIFVFFILTVAAAESAIGLAILVLLFRNKSSINVDELNTLKG
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; specifically, four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its role in R. ferrireducens metabolism?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of the NADH dehydrogenase complex (Complex I) in the electron transport chain of R. ferrireducens. This protein, encoded by the nuoK gene (locus name Rfer_1503), functions as part of the membrane-embedded domain of Complex I. The enzyme complex catalyzes the transfer of electrons from NADH to quinones while simultaneously pumping protons across the membrane, thus contributing to the generation of the proton motive force used for ATP synthesis. In R. ferrireducens, this component is particularly important due to the organism's unique electron transport chain efficiency that allows it to thrive in nutrient-depleted environments .

How does the electron transport chain of R. ferrireducens differ from other metal-reducing bacteria?

The electron transport chain of R. ferrireducens has been characterized as more efficient than that of Geobacter sulfurreducens, another acetate-oxidizing Fe(III) reducer often found in the same microbial niche. While both organisms have an H+/2e- ratio of 2 for NADH dehydrogenase, R. ferrireducens has an H+/2e- ratio of 2 for cytochrome reductase compared to G. sulfurreducens' ratio of 1. This higher efficiency in the electron transport chain suggests an evolutionary adaptation that allows R. ferrireducens to thrive in nutrient-depleted environments, whereas G. sulfurreducens is better adapted to acetate-rich environments. This difference in electron transport chain efficiency represents an important evolutionary strategy for survival in competitive microbial communities .

How does the structure of nuoK contribute to its function in the NADH dehydrogenase complex?

The nuoK protein's structure is characterized by its hydrophobic transmembrane helices that contribute to forming the membrane domain of Complex I. These structural elements create a proton-conducting pathway through the membrane, essential for the proton-pumping activity of the NADH dehydrogenase complex. The specific arrangement of amino acids with charged and polar residues within the transmembrane regions facilitates proton movement, while conserved regions likely mediate interactions with adjacent subunits to maintain the structural integrity of the complex. This structural organization is crucial for coupling electron transport from NADH to quinones with the translocation of protons across the bacterial membrane, contributing to the generation of the proton gradient used for ATP synthesis .

What post-translational modifications are known to occur in nuoK and how do they affect protein function?

While the search results do not specifically mention post-translational modifications (PTMs) of nuoK in R. ferrireducens, comparative analysis with similar bacterial systems suggests potential for phosphorylation, acetylation, or other modifications that could regulate complex assembly or activity. In bacterial respiratory complexes, PTMs often serve as regulatory mechanisms that respond to environmental or metabolic changes. For example, phosphorylation of specific residues might alter protein-protein interactions within the complex or modify the efficiency of proton translocation. Researchers investigating PTMs in nuoK should employ techniques such as mass spectrometry-based proteomics with enrichment protocols for specific modifications, followed by functional studies to correlate identified PTMs with changes in enzyme activity under different growth conditions .

What are the optimal expression systems for producing recombinant R. ferrireducens nuoK protein?

For recombinant production of R. ferrireducens nuoK protein, Escherichia coli expression systems have been successfully employed. The optimal expression strategy involves using E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), which are less susceptible to toxicity from membrane protein overexpression. Expression vectors should incorporate an N-terminal histidine tag to facilitate purification while minimizing interference with the protein's membrane integration. Given the hydrophobic nature of nuoK, expression conditions typically require lower induction temperatures (16-20°C) and reduced inducer concentrations to promote proper folding and membrane insertion. For researchers studying functional aspects, co-expression with other subunits of the NADH dehydrogenase complex might be necessary to obtain correctly assembled protein complexes .

What purification protocols yield the highest purity and activity of recombinant nuoK?

The most effective purification protocol for recombinant nuoK involves a multi-step approach designed to maintain protein stability and native conformation. After cell lysis, membrane fractions should be isolated by ultracentrifugation and solubilized using mild detergents such as n-dodecyl β-D-maltoside (DDM) or digitonin. The His-tagged protein can then be purified using immobilized metal affinity chromatography (IMAC) with careful optimization of imidazole concentrations to minimize non-specific binding while maximizing target protein yield. Size exclusion chromatography serves as a polishing step to achieve >90% purity as confirmed by SDS-PAGE. Throughout the purification process, maintaining a stable buffer system (typically Tris-based) with glycerol (up to 50%) helps preserve protein stability. The purified protein should be stored at -20°C to -80°C with the addition of 6% trehalose to prevent freeze-thaw damage .

How can researchers optimize storage conditions to maintain nuoK protein stability and activity?

To maintain optimal stability and activity of purified nuoK protein, researchers should implement the following storage protocol:

  • After purification, reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 30-50% to prevent ice crystal formation during freezing.

  • For long-term storage, aliquot the protein solution into small volumes to minimize freeze-thaw cycles.

  • Store aliquots at -80°C for extended preservation.

  • For working stocks, maintain aliquots at 4°C for up to one week.

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity.

  • Consider adding 6% trehalose as a cryoprotectant to enhance stability during freezing.

  • When thawing frozen aliquots, use rapid thawing at room temperature followed by immediate transfer to ice.

For researchers conducting activity assays, it's advisable to prepare fresh working dilutions from frozen stocks rather than repeatedly freezing and thawing the original preparation .

What methodologies are most effective for studying the electron transport function of nuoK in vitro?

The most effective methodologies for studying nuoK's electron transport function in vitro combine biochemical assays with biophysical techniques:

  • Reconstitution in proteoliposomes: Incorporate purified nuoK (preferably as part of the complete NADH dehydrogenase complex) into artificial liposomes to create a controlled system for measuring proton translocation and electron transfer.

  • NADH:ubiquinone oxidoreductase activity assays: Monitor the rate of NADH oxidation spectrophotometrically at 340 nm while measuring ubiquinone reduction, establishing the coupling ratio between electron transfer and proton translocation.

  • Membrane potential measurements: Use potential-sensitive fluorescent dyes (e.g., DiSC3(5)) in proteoliposome systems to measure the generation of membrane potential during NADH oxidation.

  • Site-directed mutagenesis: Systematically modify conserved residues to identify those critical for proton translocation or electron transfer functionality.

  • Electron paramagnetic resonance (EPR) spectroscopy: Characterize the redox centers and electron transfer pathway within the complex containing nuoK.

How can researchers accurately measure the proton-pumping efficiency of nuoK as part of the NADH dehydrogenase complex?

Accurately measuring the proton-pumping efficiency of nuoK requires sophisticated techniques that can quantify both electron transfer and proton translocation rates:

  • pH electrode measurements in reconstituted systems: Use a sealed chamber with a sensitive pH electrode to detect proton uptake or release during NADH oxidation by the reconstituted complex.

  • Fluorescent probe approach: Employ pH-sensitive fluorescent dyes (such as ACMA or pyranine) entrapped in proteoliposomes containing the complex to monitor internal pH changes during NADH oxidation.

  • Stopped-flow spectroscopy: Measure the kinetics of proton translocation with millisecond time resolution by rapidly mixing the enzyme complex with substrates and monitoring pH-dependent spectral changes.

  • Calculation of H+/e- ratios: Compare the measured rates of proton translocation with the rates of electron transfer to calculate the H+/e- stoichiometry, which for R. ferrireducens has been determined to have an H+/2e- ratio of 2 for both NADH dehydrogenase and cytochrome reductase components.

  • Comparison with model systems: Validate measurements by comparison with well-characterized bacterial systems, accounting for the unique efficiency of R. ferrireducens' electron transport chain that allows it to thrive in nutrient-depleted environments.

What advanced genetic approaches can be used to study nuoK function in vivo?

To study nuoK function in vivo, researchers can employ several advanced genetic approaches:

  • Gene deletion and complementation: Create a nuoK knockout strain of R. ferrireducens followed by complementation with wild-type or mutant versions of the gene to assess phenotypic effects on growth, electron transport efficiency, and substrate utilization.

  • Site-directed mutagenesis of chromosomal nuoK: Use CRISPR-Cas9 or recombineering techniques to introduce specific mutations into the chromosomal copy of nuoK, allowing for evaluation of functional domains under native expression conditions.

  • Reporter gene fusions: Create translational fusions between nuoK and reporter genes (such as fluorescent proteins compatible with anaerobic conditions) to study protein localization, expression levels, and response to environmental conditions.

  • Transposon mutagenesis screening: Identify genetic interactions with nuoK by screening for suppressor or synthetic lethal mutations that modify phenotypes associated with nuoK mutations.

  • RNA-seq and proteomics: Compare transcriptome and proteome profiles between wild-type and nuoK mutant strains to identify compensatory mechanisms and regulatory networks associated with nuoK function.

  • In vivo cross-linking: Identify protein-protein interactions involving nuoK in the native membrane environment using chemical cross-linking followed by mass spectrometry.

These approaches can reveal the physiological importance of nuoK in R. ferrireducens' unique metabolic capabilities, such as its ability to convert sugars to electricity and its efficient electron transport chain that differs from other Fe(III)-reducing bacteria .

How does R. ferrireducens nuoK differ from homologous proteins in other bacteria, and what are the functional implications?

R. ferrireducens nuoK exhibits several distinctive features compared to homologous proteins in other bacteria, with significant functional implications:

  • Sequence conservation and divergence: While the core structural elements of nuoK are conserved across bacterial species, R. ferrireducens nuoK shows specific amino acid substitutions that likely contribute to the organism's unique electron transport chain efficiency. These adaptations may include modifications to transmembrane helices that optimize proton translocation efficiency.

  • Functional efficiency: The NADH dehydrogenase complex containing nuoK in R. ferrireducens contributes to an electron transport chain with an H+/2e- ratio of 2 for both NADH dehydrogenase and cytochrome reductase components. This differs from G. sulfurreducens, which has an H+/2e- ratio of only 1 for cytochrome reductase, suggesting that R. ferrireducens has evolved a more energy-efficient electron transport system.

  • Environmental adaptation: The specific characteristics of R. ferrireducens nuoK likely reflect adaptation to nutrient-depleted environments, contrasting with bacteria like G. sulfurreducens that are optimized for acetate-rich conditions. This adaptation explains the ecological niche separation between these species despite their co-occurrence in similar habitats.

  • Role in diverse electron acceptor utilization: The nuoK protein in R. ferrireducens must function with a diverse range of terminal electron acceptors (Fe(III), Mn(IV), fumarate, nitrate), suggesting unique interactions within the respiratory chain that may not be present in bacteria with more limited electron acceptor repertoires.

These differences highlight how subtle variations in a conserved protein can contribute to significant metabolic and ecological differentiation between bacterial species .

What insights from the R. ferrireducens genome help explain the unique electron transport properties involving nuoK?

Genome analysis of R. ferrireducens provides several key insights that help explain the unique electron transport properties involving nuoK:

  • Genomic context of nuoK: The nuoK gene (Rfer_1503) exists within a conserved operon encoding all subunits of NADH dehydrogenase Complex I, allowing coordinated expression of this multisubunit enzyme. The genetic organization ensures appropriate stoichiometry of all components of the respiratory complex.

  • Absence of photosynthetic and fermentative pathways: Unlike other members of the Rhodoferax genus, R. ferrireducens lacks complete genetic pathways for photosynthesis and sugar fermentation. Genome analysis reveals the absence of genes encoding key fermentative enzymes like lactate dehydrogenase (LdhA), pyruvate formate lyase (PflA), and acetaldehyde CoA dehydrogenase/alcohol dehydrogenase (AdhE), explaining why the organism cannot grow fermentatively on glucose.

  • Complete TCA cycle and electron transport components: The genome encodes a full tricarboxylic acid (TCA) cycle and pentose phosphate pathway, along with a diverse set of electron transport chain components that enable versatile anaerobic respiration with various electron acceptors.

  • Substrate utilization genes: The genome contains genes for the Entner-Doudoroff glycolytic pathway (typical of Pseudomonads and Comamonas), various sugar transporters, and beta-glucosidases (Rfer_1102, Rfer_1111) that enable metabolism of diverse carbon sources including cellobiose.

These genomic features collectively explain how the electron transport chain containing nuoK supports R. ferrireducens' unique metabolic capabilities, including its ability to completely oxidize sugars to carbon dioxide while transferring electrons to Fe(III) or electrodes in microbial fuel cells .

How does the reclassification of R. ferrireducens to Albidiferax ferrireducens affect research on nuoK and related proteins?

The reclassification of Rhodoferax ferrireducens to Albidiferax ferrireducens has several implications for research on nuoK and related proteins:

  • Taxonomic context and comparative genomics: The reclassification places the organism in a more accurate phylogenetic context, facilitating more precise comparative analyses of nuoK with homologs from truly related species. This taxonomic precision helps researchers identify functionally significant sequence divergences that might otherwise be obscured by inappropriate comparisons.

  • Literature and database continuity challenges: Research performed under the previous classification must be carefully integrated with newer studies using the updated taxonomy. Databases may contain entries under both names, requiring researchers to perform comprehensive searches using both taxonomic designations to ensure complete literature coverage.

  • Functional interpretation: The reclassification emphasizes the distinctiveness of A. ferrireducens from true Rhodoferax species, particularly its inability to grow phototrophically, which has direct implications for understanding the specialization of its electron transport chain components, including nuoK.

  • Strain identification and authentication: Researchers must verify that strains designated as DSM 15236, ATCC BAA-621, or T118 in their collections correspond to the correctly reclassified organism to ensure experimental reproducibility.

  • Evolutionary perspective: The reclassification provides a more accurate framework for understanding the evolutionary adaptations of nuoK and other electron transport components in the context of the organism's ecological niche and metabolic capabilities.

For practical research purposes, scientists should now use Albidiferax ferrireducens as the current accepted name while remaining aware of the historical Rhodoferax ferrireducens designation when accessing older literature and database entries .

How can recombinant nuoK be utilized in developing improved microbial fuel cells?

Recombinant nuoK can be strategically utilized in developing improved microbial fuel cells (MFCs) through several research-driven approaches:

  • Engineered electron transport efficiency: By understanding the structural and functional properties of nuoK that contribute to R. ferrireducens' efficient electron transport chain (H+/2e- ratio of 2), researchers can engineer microbial fuel cell biocatalysts with enhanced proton-pumping efficiency, potentially increasing power output.

  • Heterologous expression in conventional MFC organisms: The nuoK gene from R. ferrireducens can be introduced into more robust or easily cultivated bacteria commonly used in MFCs (such as Shewanella or Geobacter species) to potentially transfer its efficient electron transport characteristics.

  • Structure-function studies for rational design: Detailed structural analysis of nuoK can identify critical residues for electron transport efficiency, which can then be targets for site-directed mutagenesis to create variants with enhanced performance under specific MFC operating conditions.

  • Chimeric protein engineering: Creating chimeric proteins combining domains from R. ferrireducens nuoK with homologous proteins from other electroactive bacteria may yield novel electron transport complexes with improved properties for electricity generation.

  • Biosensor development: Recombinant nuoK can be incorporated into in vitro electrode systems to develop sensitive biosensors for detecting specific substrates that interact with the NADH dehydrogenase complex.

These applications leverage R. ferrireducens' unique ability to convert sugars to electricity with complete oxidation to carbon dioxide and quantitative electron transfer to graphite electrodes, properties that make components of its electron transport chain particularly valuable for MFC research and development .

What role might nuoK research play in understanding and enhancing microbial electrosynthesis processes?

Research on nuoK has significant potential to advance microbial electrosynthesis processes through multiple mechanisms:

  • Bidirectional electron transfer insights: Understanding how nuoK contributes to the NADH dehydrogenase complex functionality can provide insights into the reverse process of electron uptake from electrodes, which is essential for electrosynthesis where electricity drives microbial synthesis of organic compounds.

  • Energy conservation mechanism elucidation: Detailed characterization of nuoK's role in coupling electron transfer to proton translocation can reveal principles for optimizing energy conservation during electrosynthesis, potentially improving conversion efficiencies.

  • Protein engineering for reverse electron flow: Modified versions of nuoK and associated electron transport components could be engineered to enhance reverse electron flow from electrodes to intracellular electron carriers like NAD(P)H, a critical step in electrosynthesis.

  • Adaptation to different electrode materials: Studies of nuoK interactions with various electron acceptors can guide the development of electrode materials optimized for specific electron transport proteins in electrosynthesis applications.

  • Integration with carbon fixation pathways: Knowledge of how nuoK contributes to R. ferrireducens' complete oxidation of sugars to CO₂ can inform strategies for coupling electron uptake to carbon dioxide fixation in electrosynthesis systems.

These research directions leverage the understanding that R. ferrireducens' electron transport chain, of which nuoK is a critical component, has unique properties that enable efficient electron transfer between cellular metabolism and external electron acceptors—a process that, when reversed, forms the basis of microbial electrosynthesis .

What are the key challenges in translating fundamental nuoK research into applied biotechnological processes?

Translating fundamental nuoK research into applied biotechnological processes faces several key challenges:

  • Protein stability outside native membrane environment: The hydrophobic nature of nuoK makes it inherently unstable when removed from its native membrane context. Researchers must develop improved stabilization methods, possibly using nanodiscs, amphipols, or synthetic membrane mimetics to maintain protein structure and function in engineered systems.

  • Reconstitution of multi-component complexes: nuoK functions as part of the larger NADH dehydrogenase complex (Complex I), which contains multiple subunits. Successfully reconstituting the entire functional complex with proper stoichiometry and correct assembly remains technically challenging for biotechnological applications.

  • Scale-up limitations: Moving from laboratory-scale expression and purification to industrial-scale production introduces significant hurdles in maintaining protein quality, activity, and cost-effectiveness. Current recombinant production methods yielding 50 μg quantities must be scaled to gram-level production for commercial viability.

  • Integration with artificial electron transport systems: Designing synthetic electron transport chains that incorporate nuoK while matching the efficiency of natural systems requires sophisticated bioengineering approaches not yet fully developed.

  • Long-term operational stability: For applications such as biosensors or biofuel cells, the protein must maintain activity under non-physiological conditions for extended periods, far beyond what would be required in its natural environment.

  • Regulatory and safety considerations: As applications move toward commercialization, regulatory frameworks for engineered biological components derived from subsurface microorganisms must be navigated, particularly for environmental applications.

Addressing these challenges requires interdisciplinary approaches combining protein biochemistry, membrane biophysics, bioengineering, and process development to bridge the gap between fundamental understanding of nuoK function and practical biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.