Recombinant Rhodoferax ferrireducens Probable intracellular septation protein A (Rfer_2397)

What is Recombinant Rhodoferax ferrireducens Probable intracellular septation protein A (Rfer_2397)?

Recombinant Rhodoferax ferrireducens Probable intracellular septation protein A (Rfer_2397) is a protein with UniProt accession number Q21VT9, derived from the bacterial strain Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118). This 179-amino acid protein is believed to play a critical role in bacterial cell division processes, specifically in intracellular septation. The complete amino acid sequence is: MKILIDFFPILLFFGAYKAYDIYIGTGVLMAATLIQMGLIYTLDRKLTVMHKITLALILVFGTLTLVLHDERFIKWKPTVLYAAMAIGLALAVWVWKKNFLKLLLGSQMELPDPVWMRLNMVWVVYCVFMSLINAYVAAYYSTEAWVNFKLWGYAFPLVFIVAQGFYISRYLKTDEPKA .

How does Rfer_2397 contribute to bacterial cell division processes?

While the specific mechanisms of Rfer_2397 have not been comprehensively characterized, septation proteins generally function as critical components in the bacterial cell division machinery. Based on research on septation processes, these proteins typically participate in the formation of the septum that divides bacterial cells during reproduction. Methodologically, researchers can investigate this function through comparative analysis with better-characterized septation systems, such as those involving mitotic-spindle organizing proteins like MztA, which has been identified as a positive septation regulator . The protein likely interacts with microtubule-like structures and may coordinate with components of the septation initiation network (SIN) to regulate the timing and positioning of the division septum. This coordination is essential for proper chromosome segregation and daughter cell formation .

What cellular structures are associated with Rfer_2397 in bacterial cells?

Based on current understanding of septation proteins, Rfer_2397 likely associates with several critical cellular structures during cell division. Similar septation proteins have been observed to localize to the septation site, forming ring-like structures that gradually accumulate at the central region of the division plane . For experimental visualization, researchers typically employ techniques such as fluorescence microscopy with fluorescent protein fusions (e.g., GFP-tagged constructs) combined with membrane and DNA staining. This approach allows for the observation of protein localization relative to chromosomal DNA (using DAPI staining) and membrane invagination sites during division . By analogy with other septation systems, Rfer_2397 may also associate with spindle pole body-like structures at certain stages of the cell cycle, similar to how MobA has been observed to localize at both the SPB and septum site in mature cells .

What is the predicted membrane topology of Rfer_2397?

Based on the amino acid sequence of Rfer_2397, hydropathy analysis suggests it contains multiple hydrophobic regions that may function as transmembrane domains. The methodological approach to determining membrane topology would include:

• Computational prediction using algorithms such as TMHMM, Phobius, or TopPred

• Experimental validation using techniques like PhoA fusion or cysteine accessibility methods

• Structural analysis through techniques such as cryo-electron microscopy

The hydrophobic character of multiple segments in the protein sequence (MKILIDFFPILLFFGAYKAYDIYIGTGVLMAATLIQMGLIYTLDRK...) strongly suggests membrane association, which would be consistent with a role in membrane remodeling during septation . This membrane-associated topology would position the protein to participate in the invagination of the cell membrane during division, a critical step in bacterial septation.

How does Rfer_2397 interact with other components of the septation machinery?

Understanding the interaction network of Rfer_2397 requires sophisticated methodological approaches that can capture both stable and transient protein-protein interactions. Current research on septation proteins suggests they function within multiprotein complexes that coordinate the division process. To elucidate these interactions:

• Implement bacterial two-hybrid screening to identify potential binding partners

• Perform co-immunoprecipitation with tagged Rfer_2397 followed by mass spectrometry

• Use fluorescence resonance energy transfer (FRET) to validate interactions in vivo

• Apply crosslinking mass spectrometry to map specific interaction interfaces

Research on comparable systems indicates that septation proteins often interact with components like MobA, which localizes to the septation site forming a ring structure . These interactions likely form part of a regulatory network that ensures proper timing and positioning of septum formation during cell division. The methodology used for studying MztA-mediated septation could be adapted, where fluorescent protein tagging revealed localization patterns and genetic approaches identified functional relationships with other division proteins .

What are the effects of Rfer_2397 mutations on bacterial morphology and division dynamics?

To systematically investigate the phenotypic consequences of Rfer_2397 mutations, researchers should employ a multifaceted methodological approach:

• Generate a complete deletion mutant using homologous recombination or CRISPR-Cas9

• Create point mutations in conserved domains to identify critical functional residues

• Develop conditional expression systems to study essential functions

• Analyze resulting phenotypes using:

  • Time-lapse microscopy to track division dynamics

  • Electron microscopy for ultrastructural analysis

  • Fluorescent staining of cell wall, membrane, and DNA

Based on studies of other septation proteins, mutations might result in phenotypes such as filamentous growth (elongated cells without division), misplaced septa, or chromosome segregation defects . Quantitative analysis should include measurements of cell length distribution, division frequency, and septum positioning. The methodology described for studying MztA function in septation provides a valuable template, where researchers used multiple microscopy techniques including Calcofluor white staining to visualize septa and DAPI to track chromosome dynamics .

How is Rfer_2397 expression regulated during the bacterial cell cycle?

The regulation of septation proteins is typically tightly coordinated with cell cycle progression. To elucidate the regulatory mechanisms controlling Rfer_2397 expression and activity:

• Perform transcriptomic analysis (RNA-Seq) across synchronized cell populations

• Use quantitative RT-PCR to measure mRNA levels throughout the cell cycle

• Develop reporter constructs (e.g., luciferase or fluorescent protein fusions to the Rfer_2397 promoter)

• Apply ChIP-seq to identify transcription factors binding to the Rfer_2397 regulatory regions

• Investigate post-translational modifications using phosphoproteomics

Research on comparable septation systems suggests regulation may involve both transcriptional control and post-translational modifications that modulate protein activity or localization . The specific timing of Rfer_2397 expression relative to other cell cycle events would provide insights into its functional role in the division process. Additionally, researchers should examine potential checkpoint mechanisms that might couple Rfer_2397 activity to chromosome replication and segregation, ensuring that division occurs only after genetic material has been properly distributed.

What are the optimal conditions for expressing and purifying recombinant Rfer_2397?

The successful expression and purification of Rfer_2397 requires careful optimization of multiple parameters:

Expression System Selection:

• For membrane proteins like Rfer_2397, specialized E. coli strains such as C41(DE3) or C43(DE3) often yield better results than standard BL21(DE3)

• Consider testing expression in bacterial species more closely related to Rhodoferax ferrireducens if E. coli yields are poor

Expression Optimization:

• Test multiple vectors with different promoters and fusion tags

• Optimize induction parameters (temperature, inducer concentration, time)

• For membrane proteins, expression at lower temperatures (16-20°C) often improves folding

• Consider codon optimization for the expression host

Purification Strategy:

• Use affinity chromatography with a suitable tag (His-tag is common for recombinant proteins)

• For membrane proteins, screening of detergents is critical (test DDM, LDAO, CHAPS)

• Implement size exclusion chromatography as a final purification step

• Verify purity using SDS-PAGE and Western blotting

Storage Conditions:
Based on available information, the recombinant protein should be stored in Tris-based buffer with 50% glycerol. For extended storage, maintain at -20°C or -80°C, and avoid repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week .

What techniques are most effective for visualizing Rfer_2397 localization during cell division?

To track the dynamic localization of Rfer_2397 throughout the bacterial cell cycle, researchers should employ advanced microscopy techniques:

• Construct fluorescent protein fusions (GFP or mCherry) to either terminus of Rfer_2397

• Verify that fusion proteins retain functionality through complementation assays

• Implement time-lapse fluorescence microscopy with environmental control

• Apply super-resolution techniques (STED, PALM, STORM) for precise localization

• Use multi-color imaging to simultaneously track:

  • Rfer_2397 (fluorescent protein fusion)

  • DNA (DAPI staining)

  • Cell membrane (membrane-specific dyes)

  • Cell wall (Calcofluor white staining)

The methodology described for studying MobA localization provides an excellent template, where researchers visualized protein dynamics by expressing GFP-tagged proteins and tracked localization relative to cellular structures using appropriate stains . For quantitative analysis, fluorescence intensity profiles across the cell should be measured at different time points to characterize the dynamic redistribution of the protein during division.

How can researchers distinguish between direct and indirect effects when studying Rfer_2397 function?

Differentiating between primary and secondary effects of Rfer_2397 perturbation requires rigorous experimental design:

• Implement rapid protein depletion or inactivation systems (e.g., degron tags, photoinactivation)

• Perform time-course experiments to establish the sequence of cellular responses

• Use proximity labeling techniques (BioID, APEX) to identify proteins in direct contact with Rfer_2397

• Develop in vitro reconstitution assays with purified components

• Apply genetic suppression analysis to identify functional relationships

The key methodological principle is to distinguish immediate consequences of Rfer_2397 loss or mutation from downstream effects that propagate through cellular networks. Similar approaches have been used to study the functional relationships between septation proteins like MztA and ParA, where genetic studies revealed their coordinated roles in septation regulation . By combining rapid perturbation methods with high-resolution time-lapse imaging, researchers can establish causal relationships and build models of Rfer_2397 function within the septation machinery.

What statistical approaches should be used to analyze variability in Rfer_2397 localization patterns?

The quantitative analysis of Rfer_2397 localization patterns requires robust statistical methods to account for cell-to-cell variability:

• Implement automated image analysis to extract localization data from large numbers of cells

• Classify localization patterns using machine learning approaches

• Apply appropriate statistical tests:

  • For continuous measurements (e.g., position of maximum intensity): ANOVA or non-parametric alternatives

  • For categorical data (e.g., pattern classifications): Chi-square or Fisher's exact test

• Control for potential confounding variables such as cell size, growth phase, and expression level

• Present data using appropriate visualizations (violin plots, cumulative distribution functions)

The demographic reporting table below illustrates the importance of comprehensive variable reporting, which should be adapted for Rfer_2397 localization studies:

This approach to data analysis provides more sophisticated insights than simply reporting mean values, allowing researchers to identify subpopulations and heterogeneity in Rfer_2397 behavior .

How can contradictory findings about Rfer_2397 function from different experimental approaches be reconciled?

When faced with apparently contradictory results regarding Rfer_2397 function, researchers should apply a systematic reconciliation framework:

• Critically evaluate methodological differences between studies:

  • Expression systems and protein tags used

  • Experimental conditions (temperature, media, growth phase)

  • Strain backgrounds and potential genetic modifiers

  • Sensitivity and specificity of different assays

• Design targeted experiments to directly address contradictions:

  • Perform side-by-side comparisons under identical conditions

  • Implement orthogonal methods to validate key findings

  • Consider context-dependent functions that might explain discrepancies

• Develop integrated models that accommodate seemingly contradictory observations:

  • Consider multifunctional roles of Rfer_2397 in different contexts

  • Examine potential regulatory mechanisms that might switch protein function

  • Evaluate whether different studies are examining distinct aspects of a complex process

This approach recognizes that apparent contradictions often reflect different facets of complex biological systems. Research on septation proteins like MztA has shown that they can have context-dependent functions, interacting differently with various partners (e.g., ParA) depending on cellular conditions .

What bioinformatic approaches can help predict the function of uncharacterized domains in Rfer_2397?

For proteins like Rfer_2397 with limited experimental characterization, bioinformatic methods can provide valuable functional insights:

• Implement sequence-based analyses:

  • Position-specific iterative BLAST (PSI-BLAST) to identify distant homologs

  • Multiple sequence alignment to identify conserved residues

  • Hidden Markov Models (HMMs) to detect conserved domains

• Apply structure prediction methods:

  • AlphaFold or RoseTTAFold for ab initio structure prediction

  • Template-based modeling using structures of related proteins

  • Molecular dynamics simulations to explore conformational dynamics

• Use genomic context analysis:

  • Examine gene neighborhood conservation across bacterial species

  • Identify co-occurrence patterns with other genes

  • Analyze phylogenetic profiles to detect functional associations

• Integrate with experimental data:

  • Map predictions to phenotypic effects of mutations

  • Guide the design of targeted functional assays

  • Prioritize specific domains for detailed characterization

These computational approaches can generate testable hypotheses about domain functions and protein interactions, guiding experimental design and interpretation. For instance, structural modeling might reveal potential binding interfaces that could mediate interactions with other septation proteins or identify catalytic sites that suggest enzymatic functions .

How should researchers design experiments to study Rfer_2397 interactions with the chromosome during division?

To investigate potential interactions between Rfer_2397 and chromosomal DNA during bacterial cell division:

• Implement Chromatin Immunoprecipitation (ChIP) with tagged Rfer_2397:

  • Use crosslinking to capture transient DNA-protein interactions

  • Sequence precipitated DNA (ChIP-seq) to identify binding sites

  • Validate specific interactions using electrophoretic mobility shift assays (EMSA)

• Apply microscopy-based approaches:

  • Perform dual-color fluorescence microscopy with labeled Rfer_2397 and DNA

  • Implement 3D structured illumination microscopy for high-resolution colocalization analysis

  • Use time-lapse imaging to track the relative dynamics of Rfer_2397 and chromosomes

• Employ genetic approaches:

  • Create mutations in potential DNA-binding domains

  • Analyze effects on chromosome segregation using fluorescently-labeled nucleoid markers

  • Test for synthetic phenotypes with mutations in known chromosome segregation factors

This experimental design approach would help determine whether Rfer_2397 directly interacts with DNA or indirectly influences chromosome dynamics during division. Similar methodologies have been used to study septation proteins in other systems, revealing connections between septation and chromosome segregation processes .

What controls are essential when studying the effects of Rfer_2397 overexpression or depletion?

Rigorous control strategies are critical when manipulating Rfer_2397 expression levels:

• Expression Controls:

  • Quantify protein levels by Western blotting to confirm overexpression or depletion

  • Use qRT-PCR to measure mRNA levels

  • Include wild-type strains grown under identical conditions

  • Implement titrable expression systems to establish dose-response relationships

• Specificity Controls:

  • Complement deletion mutants with wild-type Rfer_2397 to confirm phenotype causality

  • Overexpress unrelated proteins at similar levels to control for general expression burden

  • Create point mutations in functional domains rather than complete deletions

  • Test multiple independent mutant or overexpression strains

• Phenotypic Controls:

  • Measure growth rates under various conditions

  • Quantify cell dimensions and morphological parameters

  • Include known septation mutants as positive controls

  • Examine effects on multiple cellular processes to assess specificity

• Timing Controls:

  • Synchronize cell populations when studying cell cycle-dependent effects

  • Perform time-course experiments after induction or repression

  • Use time-lapse microscopy to determine the sequence of phenotypic changes