Recombinant Rhodoferax ferrireducens Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

The Protease HtpX homolog from Rhodoferax ferrireducens is a membrane-bound metalloprotease identified within the genome of R. ferrireducens strain DSM 15236 / ATCC BAA-621 / T118. It is encoded by the htpX gene (locus tag: Rfer_3463) and has been assigned the UniProt accession number Q21ST3 . The protease belongs to the broader family of HtpX proteases, which are widely distributed across bacterial species and play critical roles in protein quality control mechanisms. These proteases are typically classified under EC 3.4.24.-, denoting their function as zinc-dependent metalloproteases that cleave peptide bonds with non-terminal amino acids . The full-length protein consists of 291 amino acids and represents a complete expression region within the bacterial genome.

Functional Significance in Cellular Processes

As a member of the HtpX family, the R. ferrireducens protease homolog is presumed to participate in protein quality control mechanisms within the cell membrane. While specific experimental validation for this particular homolog is limited in the available literature, comparative analysis with other bacterial HtpX proteases suggests its involvement in degrading misfolded or damaged membrane proteins during stress conditions. The protein likely works in concert with other quality control systems to maintain membrane protein homeostasis, particularly under conditions that promote protein misfolding such as heat stress or oxidative damage. This functional role would be consistent with R. ferrireducens' documented ability to survive in challenging subsurface environments with various environmental stressors .

Ecological Significance and Metabolic Versatility

Rhodoferax ferrireducens is a facultative anaerobic bacterium that has garnered scientific interest due to its remarkable metabolic adaptability and ecological importance. This microorganism plays a crucial role in carbon and metal cycling within subsurface environments . R. ferrireducens possesses the unique ability to reduce Fe(III), making it a key player in geochemical processes that influence mineral formation and dissolution in aquatic sediments and groundwater systems. Genome analysis and experimental studies have revealed that R. ferrireducens can utilize a diverse range of carbon sources, including complex sugars and organic acids, demonstrating its metabolic flexibility . This versatility likely contributes to the organism's success in colonizing various ecological niches and adapting to fluctuating environmental conditions.

Biotechnological Applications

One of the most remarkable features of R. ferrireducens is its capacity to convert sugars to electricity through a process that involves complete oxidation of organic compounds to carbon dioxide with concomitant electron transfer to external acceptors . This ability has positioned R. ferrireducens as a promising candidate for microbial fuel cell applications, where bacterial metabolism can be harnessed for sustainable energy production. Beyond energy applications, genome-scale modeling and experimental approaches have unveiled additional physiological capabilities that expand our understanding of this organism's biotechnological potential. These include the ability to metabolize cellobiose and citrate, as well as the presence of novel genes involved in benzoate metabolism . Furthermore, R. ferrireducens demonstrates resilience against various environmental stressors, including heavy metals, aromatic compounds, nutrient limitation, and oxidative stress, highlighting its potential applications in bioremediation efforts .

Genomic Insights

Comprehensive genomic analysis of R. ferrireducens has provided valuable insights into the genetic basis of its physiological capabilities. The complete genome sequence annotation has revealed the presence of genes involved in various metabolic pathways, stress response mechanisms, and electron transport systems . Among these genetic elements, the htpX gene (Rfer_3463) encodes the Protease HtpX homolog that is the focus of this report. Genomic studies have also explained certain metabolic limitations of R. ferrireducens compared to other members of the Rhodoferax genus, such as its inability to grow via photosynthesis or ferment sugars . This information has been instrumental in constructing constraint-based metabolic models that accurately predict the organism's growth patterns and substrate utilization capabilities.

Recombinant Expression Systems

The production of Recombinant Rhodoferax ferrireducens Protease HtpX homolog typically employs heterologous expression systems, with Escherichia coli being the predominant host organism for recombinant protein production. This approach allows for controlled expression and simplified purification of the target protein. While specific details regarding expression constructs for the HtpX protease are not extensively documented in the available literature, comparison with other recombinant proteins from R. ferrireducens suggests that expression typically involves vector systems optimized for membrane protein production . The expression strategy must account for the inherent challenges associated with producing membrane-bound proteins, which often require specialized expression vectors, host strains, and cultivation conditions to achieve proper folding and functionality.

Purification and Quality Assessment

Purification of recombinant HtpX protease likely involves a combination of techniques optimized for membrane proteins. The commercially available recombinant protein is typically supplied with a tag (though the specific tag type may vary depending on the production process) to facilitate purification and detection . Quality assessment of the purified protein is performed using SDS-PAGE analysis, with commercial preparations typically achieving greater than 90% purity, similar to other recombinant proteins from R. ferrireducens . The purified protein is commonly provided in a stabilized form, either as a solution in a Tris-based buffer containing 50% glycerol or as a lyophilized powder that requires reconstitution before use .

Enzymatic Activity and Substrate Specificity

The HtpX protease from R. ferrireducens is classified as a metalloprotease with the EC number 3.4.24.-, indicating its function in hydrolyzing internal peptide bonds in proteins . While detailed enzymatic characterization of this specific homolog is not extensively documented in the available literature, insights can be drawn from comparative analysis with other HtpX family proteases. These enzymes typically require zinc ions for catalytic activity and demonstrate specificity for membrane protein substrates, particularly those that are misfolded or damaged. The catalytic mechanism likely involves a zinc-activated water molecule that attacks the peptide bond, facilitated by conserved residues within the active site. Experimental validation of the specific substrate preferences and kinetic parameters of the R. ferrireducens HtpX homolog represents an important area for future research.

Structure-Function Relationships

Analysis of the amino acid sequence reveals potential structure-function relationships that govern the activity of the HtpX protease. The protein contains multiple transmembrane domains that anchor it within the cell membrane, positioning the catalytic domain to access substrate proteins within the membrane or at membrane interfaces . The specific arrangement of these domains is crucial for the protein's function in quality control mechanisms. The catalytic domain likely contains conserved motifs associated with zinc binding and catalysis, although the precise residues involved in these functions require experimental confirmation. Understanding these structure-function relationships would provide valuable insights into the molecular mechanisms underlying the protease's activity and substrate recognition.

Comparative Analysis with Other Proteases

When compared to other proteases, including those from the HtpX family in different organisms, the R. ferrireducens HtpX homolog shows both conserved features and unique characteristics. Table 1 presents a comparative analysis of key features between the R. ferrireducens HtpX protease and related proteases from other bacterial species.

Table 1: Comparative Analysis of R. ferrireducens HtpX Protease with Related Proteases

FeatureR. ferrireducens HtpX ProteaseTypical Bacterial HtpX ProteasesOther Membrane Metalloproteases
Length291 amino acids250-300 amino acidsVariable (200-500 amino acids)
Catalytic MechanismZinc-dependentZinc-dependentMay use zinc or other metals
Membrane AssociationMultiple transmembrane domainsMultiple transmembrane domainsVariable (1-12 transmembrane domains)
Cellular FunctionPresumed protein quality controlProtein quality controlVarious (protein maturation, signaling, etc.)
Substrate SpecificityNot fully characterizedMisfolded membrane proteinsDiverse depending on protease type

Biotechnological Applications

The Recombinant Rhodoferax ferrireducens Protease HtpX homolog holds promise for various biotechnological applications, leveraging both its proteolytic activity and the unique characteristics of its source organism. Potential applications include enzymatic degradation of protein-based environmental contaminants, development of novel protein processing tools for industrial processes, and applications in analytical biochemistry. The protease's presumed ability to function under various stress conditions, reflecting the adaptability of its source organism, may make it particularly valuable for processes requiring robust enzymatic activity in challenging environments. Additionally, the protein's membrane-associated nature could be exploited for applications involving membrane protein manipulation or membrane-targeted proteolysis.

Role in Understanding Bacterial Stress Responses

Research on the HtpX protease from R. ferrireducens can contribute to our broader understanding of bacterial stress response mechanisms, particularly those related to membrane protein homeostasis. R. ferrireducens' documented ability to thrive in environments with various stressors, including heavy metals and oxidative stress , suggests that its protein quality control systems, including the HtpX protease, play important roles in stress adaptation. Comparative studies examining the expression and activity of the HtpX protease under different stress conditions could provide insights into stress response pathways in R. ferrireducens and related bacteria. Such knowledge would not only enhance our understanding of bacterial physiology but could also inform strategies for controlling bacterial growth or exploiting bacterial capabilities in biotechnological applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
htpX; Rfer_3463; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) (Albidiferax ferrireducens)
Target Names
htpX
Target Protein Sequence
MKRILLFVLTNVAVVAVLGIVASLLGVNRYLTASGLDLGSLLGFALVIGFGGAIISLLIS KPMAKWTTGVRIISQPQNVDEAWIVETVRKLADTAGIGMPEVGIFDGAPNAFATGAFKNS ALVAVSTGLLQGMTREEIEAVIGHEVAHVANGDMVTMALIQGVMNTFVVFLSRVIAFAID GFLRKGDERSSGPGIGYMITTVVLDIVLGFAAAIVVAWFSRHREFRADAGAAKLMNRKQP MINALARLGGMTPGELPKSMAAMGIAGGIGKLFSTHPPIEERIAALQNAPL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhodoferax ferrireducens Protease HtpX homolog and what is its fundamental function?

Protease HtpX homolog from Rhodoferax ferrireducens is a membrane-bound zinc metalloproteinase belonging to the M48 family. This protein participates in the proteolytic quality control of membrane proteins, which is essential for maintaining proper membrane structure and function. As a putative zinc metalloprotease, it plays a crucial role in eliminating malfolded or misassembled membrane proteins that could potentially disrupt normal cellular activities . The protein contains four hydrophobic regions (H1-H4) that likely function as transmembrane segments, though there remains some controversy about whether the two C-terminal regions are actually embedded in the membrane .

How should researchers properly store and handle recombinant HtpX protein for experimental work?

For optimal stability and activity, recombinant Rhodoferax ferrireducens Protease HtpX homolog should be stored in a Tris-based buffer with 50% glycerol, which is optimized for this specific protein . The recommended storage temperature is -20°C for regular use, while -80°C is preferred for extended storage periods .

Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles . It is particularly important to note that repeated freezing and thawing is not recommended as this can lead to protein denaturation and loss of enzymatic activity . The typical quantity available for research purposes is 50 μg, though other quantities may also be available based on experimental needs .

What methodologies are most effective for studying HtpX protease activity in vitro and in vivo?

For effective study of HtpX protease activity, researchers have developed several methodological approaches. One particularly valuable system is an in vivo semiquantitative protease activity assay established for HtpX that enables detection of differential protease activities of HtpX mutants carrying mutations in conserved regions . This system involves:

  • Construction of a model substrate specific to HtpX

  • Establishment of a detection system for proteolytic products

  • Implementation of controls to ensure specificity

This methodology allows for convenient analysis of HtpX activity and would be useful for investigating the functions of HtpX homologs in other bacteria beyond the model E. coli system . For in vitro studies, purified recombinant protein can be used in conjunction with artificial substrates containing appropriate recognition sequences to assess proteolytic activity under controlled conditions.

How does the function of HtpX in Rhodoferax ferrireducens compare to its homologs in other bacterial species?

Comparative studies of HtpX homologs across bacterial species reveal important evolutionary relationships and functional similarities. Computational proteomic analysis has shown that Polynucleobacter necessarius was likely the ancestor of many organisms containing HtpX-like proteins, with related organisms generally clustering together phylogenetically . This suggests they might share common pathogenic strategies and similar functional mechanisms .

The E. coli HtpX homolog has been more extensively studied and has been demonstrated to be involved in the quality control of cytoplasmic membrane proteins . While specific functional studies on Rhodoferax ferrireducens HtpX are more limited, the conserved structural features and phylogenetic relationships suggest similar roles in membrane protein quality control, albeit potentially with species-specific substrate preferences or regulatory mechanisms .

What bioinformatic approaches can be used to characterize HtpX structure, function, and evolutionary relationships?

A comprehensive bioinformatic characterization of HtpX proteins can employ multiple computational tools:

Analytical ApproachTool/MethodPurpose
Sequence retrievalUniProtObtaining protein sequence data
Homology searchUniProt BLASTIdentifying related proteins
Physicochemical characterizationProtParamDetermining physical and chemical properties
Multiple sequence alignmentCLUSTALWComparing sequences across species
Phylogenetic analysisMEGA11Establishing evolutionary relationships
Virulence predictionVirulentPredAssessing pathogenic potential
Protein disorder predictionPONDRIdentifying flexible/disordered regions
Pathway analysisPathway CommonsMapping metabolic and signaling pathways
Protein-protein interactionsSTRINGIdentifying interaction partners
Evolutionary rate estimationConSurfIdentifying conserved functional residues

These computational approaches have revealed that HtpX homologs typically contain 279-336 amino acids, range from slightly acidic to basic in nature, and are thermally stable and hydrophobic . The disordered regions (18.53-43.69% of the sequence) provide functional flexibility, allowing these proteins to assemble linkers and macromolecular complexes that can attach to host cell receptors .

What experimental systems can be developed to identify physiological substrates of HtpX protease?

Identifying the physiological substrates of HtpX protease requires sophisticated experimental approaches:

  • Substrate Trapping: Creating catalytically inactive HtpX mutants (by mutating the zinc-binding motif) that can still bind substrates but not cleave them, followed by co-immunoprecipitation and mass spectrometry analysis.

  • Comparative Proteomics: Comparing membrane proteomes of wild-type cells versus htpX deletion mutants under various stress conditions to identify proteins that accumulate in the absence of HtpX.

  • Model Substrate Development: Similar to the approach used for E. coli HtpX, constructing model substrates for Rhodoferax ferrireducens HtpX enables detection of proteolytic activity . These model substrates can incorporate reporter systems (such as fluorescent proteins or epitope tags) to facilitate easy detection of cleavage products.

  • In vivo Assay Systems: Establishing semiquantitative and convenient protease activity assay systems allows for the detection of differential protease activities of HtpX mutants carrying mutations in conserved regions . This approach can help identify substrate recognition determinants.

How can researchers effectively express and purify recombinant HtpX for structural and functional studies?

Effective expression and purification of membrane proteins like HtpX present unique challenges that require specific methodological approaches:

  • Expression Systems:

    • Bacterial systems (E. coli) with specialized strains designed for membrane protein expression

    • Expression tags that can be determined during the production process to enhance solubility and purification

    • Careful control of induction conditions to prevent inclusion body formation

  • Membrane Extraction:

    • Use of mild detergents to solubilize the membrane fraction

    • Screening of different detergent types and concentrations for optimal extraction

    • Maintaining proper folding during the extraction process

  • Purification Strategy:

    • Affinity chromatography using the attached tag (His-tag is common)

    • Size exclusion chromatography to ensure homogeneity

    • Storage in stabilizing buffer containing 50% glycerol

  • Quality Control:

    • Assessing purity by SDS-PAGE

    • Confirming identity by mass spectrometry

    • Verifying activity with model substrates

What are the challenges in studying membrane proteases like HtpX and how can they be addressed?

Studying membrane proteases like HtpX presents several significant challenges:

ChallengeDescriptionPotential Solutions
Membrane localizationDifficult to express and purify in active formUse of specialized detergents; membrane-mimetic systems (nanodiscs, liposomes)
Substrate identificationPhysiological substrates often unknownSubstrate trapping approaches; comparative proteomics; model substrate development
Assay developmentDifficulty monitoring activity in membrane environmentIn vivo reporter systems; fluorescence-based assays; model substrate development
Structural analysisMembrane proteins resist crystallizationCryo-EM; computational modeling; NMR of specific domains
Functional redundancyOverlapping functions with other proteasesMultiple gene deletions; stress conditions to enhance phenotypes

Addressing these challenges requires multidisciplinary approaches combining molecular biology, biochemistry, structural biology, and computational methods. The development of specialized tools like the in vivo protease activity assay system for HtpX represents important progress in overcoming these obstacles .

What is the potential significance of HtpX in pathogenic processes and antimicrobial development?

Protease HtpX homolog has been associated with endodontic infections, suggesting its potential role in pathogenicity . As a membrane-bound zinc metalloprotease involved in protein quality control, any structural or functional disturbance in this protein may lead to bacterial membrane dysfunction and potentially altered virulence characteristics .

The participation of HtpX in proteolytic quality control of membrane proteins suggests it could be essential for bacterial adaptation to stress conditions encountered during infection. While computational analyses have indicated that the selected HtpX proteins studied were non-virulent themselves, their function may still indirectly contribute to bacterial persistence and survival in host environments .

For antimicrobial development, targeting HtpX could potentially disrupt membrane homeostasis, particularly under stress conditions. The identified conserved and exposed residues (19 in total) might serve as potential binding sites for small molecule inhibitors . Additionally, understanding the protein-protein interaction network of HtpX, which includes partners like def, Pnec_1775, fmt, Pnec_1774, and others, could reveal additional targets for combination therapies .

How might understanding HtpX function contribute to broader research on bacterial stress responses?

Understanding HtpX function can provide valuable insights into bacterial stress response mechanisms:

  • Membrane Homeostasis: HtpX's role in proteolytic quality control of membrane proteins suggests it helps maintain membrane integrity under stress conditions . This is critical for bacterial survival in changing environments.

  • Stress Response Integration: Protein quality control systems like HtpX likely interconnect with other stress response pathways. The protein-protein interaction network identified through STRING analysis reveals connections with other stress-related proteins like ftsH and grpE .

  • Evolutionary Adaptations: The phylogenetic analysis showing Polynucleobacter necessarius as the ancestor of selected organisms with HtpX homologs suggests evolutionary conservation of this stress response mechanism . The clustering of related organisms indicates they might share common strategies for coping with environmental stresses.

  • Functional Flexibility: The significant proportion of disordered regions (18.53-43.69%) in HtpX proteins provides functional flexibility, allowing them to form macromolecular complexes and respond to various stress conditions . This may contribute to bacterial adaptability under changing environmental conditions.

What are the most promising avenues for future research on Rhodoferax ferrireducens HtpX?

Several promising research directions could advance our understanding of Rhodoferax ferrireducens HtpX:

  • Structural Characterization: Determining the three-dimensional structure of Rhodoferax ferrireducens HtpX would significantly enhance our understanding of its mechanism. While challenging due to its membrane localization, advances in cryo-electron microscopy make this increasingly feasible.

  • Substrate Identification: Developing methods to identify physiological substrates of Rhodoferax ferrireducens HtpX would clarify its specific biological role. Comparative proteomics approaches comparing wild-type and htpX deletion strains could reveal accumulated substrates.

  • Regulatory Mechanisms: Investigating how HtpX activity is regulated in response to different stress conditions would provide insights into bacterial stress adaptation. This might involve transcriptional, translational, or post-translational regulation.

  • Comparative Analysis: Expanding comparative studies of HtpX homologs across diverse bacterial species could reveal evolutionary adaptations in protein quality control systems. The established in vivo assay system could be adapted for studying HtpX homologs in other bacteria .

  • Inhibitor Development: The identified conserved and exposed residues offer potential targets for developing specific inhibitors that could serve as antimicrobial agents or research tools .

What methodological innovations would advance research on membrane proteases like HtpX?

Advancing research on membrane proteases like HtpX requires methodological innovations:

  • Improved Expression Systems: Development of specialized expression systems optimized for membrane proteases would enhance yield and activity of recombinant proteins for study.

  • Advanced Imaging Techniques: Implementation of super-resolution microscopy and single-molecule tracking could provide insights into HtpX localization and dynamics within bacterial membranes.

  • Membrane-Mimetic Systems: Utilization of nanodiscs, liposomes, or other membrane-mimetic systems would enable study of HtpX in environments more closely resembling native membranes.

  • Machine Learning Approaches: Application of machine learning for substrate prediction and inhibitor design could accelerate discovery of HtpX functions and potential therapeutic applications.

  • CRISPR-Based Screening: Development of CRISPR-based screens to identify genetic interactions and functional connections would place HtpX within broader cellular networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.