Recombinant Rhodoferax ferrireducens UPF0761 membrane protein Rfer_2991 (Rfer_2991)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Rfer_2991 is commercially available as a lyophilized powder (Creative BioMart Cat.#: RFL28263RF) with the following specifications:

ParameterDetails
Expression SystemE. coli
TagN-terminal 6xHis
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0); avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage

The protein is not intended for human use and is strictly for research purposes .

Research Applications

Rfer_2991 is primarily used in:

  1. Structural Biology: Crystallization or cryo-EM studies to resolve its transmembrane architecture.

  2. Functional Assays: Investigating its role in ion transport, redox reactions, or stress responses.

  3. Membrane Protein Interaction Studies: Partner identification via pull-down assays leveraging its His tag .

Limitations and Future Directions

  • Functional Unknowns: The UPF0761 domain’s role remains uncharacterized.

  • Biophysical Challenges: Hydrophobic TMDs may complicate solubilization and crystallization.

  • Evolutionary Context: Comparative studies with homologs in Rhodoferax antarcticus or R. ferrireducens could clarify its ecological adaptations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Rfer_2991; UPF0761 membrane protein Rfer_2991
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-416
Protein Length
full length protein
Species
Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) (Albidiferax ferrireducens)
Target Names
Rfer_2991
Target Protein Sequence
MHMPPHLPASPPLSWPQRLEALLKDLTNFPWKSTARTLRERYSEDRLGLTASSLTFTTTM ALVPLVTVALAIFTAFPMFAKLQSVLQKWLVTSLIPDNIARQVLGYLTQFAGQASKLGGA GIALLLVTAVALILTIDHTLNGIWRVRTRRSLGQRVLVYWAALTLGPLVLGVSLSITSYA ISASKGVVGVMPGGVQFLLDVLQFFMVAWGMAAMYHFVPNTWVKWSHAWAGGMFVSAGLE LAKKLLALYLGKVPTYSVLYGAFATVPILLIWIYVAWIIVLLGAVIAAYLPSLTSGIQHR GRSHGLQFQLALETLQQLERVRSDAVKGLTMQQLAQLLRVDALQLEPVLETLSELDWIGL LNEEFKGEAARYVMLANPDATALAPLLDTLLLRREESTQNLWEKGRWPLLNVRDVL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Rhodoferax ferrireducens UPF0761 membrane protein Rfer_2991?

Recombinant Rhodoferax ferrireducens UPF0761 membrane protein Rfer_2991 is a full-length (416 amino acids) membrane protein originally derived from the bacterium Rhodoferax ferrireducens strain T118 (ATCC BAA-621 / DSM 15236). When produced recombinantly, it is typically expressed in E. coli with an N-terminal His-tag to facilitate purification and downstream applications . The protein belongs to the UPF0761 family of membrane proteins, a group that remains functionally uncharacterized despite having predicted structural features. The UniProt accession number for this protein is Q21U51, which can be used to access additional sequence and annotation information across biological databases .

What structural information is available for Rfer_2991?

The three-dimensional structure of Rfer_2991 has been computationally modeled using AlphaFold (model ID: AF-Q21U51-F1), which was released in AlphaFold DB on December 9, 2021, and last modified on September 30, 2022 . This model has a global confidence score (pLDDT) of 77.4, placing it in the "Confident" category (70 < pLDDT ≤ 90) . It is important to note that this is a computed structure model without experimental verification. The confidence score breakdown shows variable reliability across different regions of the protein:

  • Very high confidence regions (pLDDT > 90): Limited portions of the structure

  • Confident regions (70 < pLDDT ≤ 90): Most of the structured domains

  • Low confidence regions (50 < pLDDT ≤ 70): Some connecting regions

  • Very low confidence regions (pLDDT ≤ 50): Likely unstructured in isolation

Researchers should consider these confidence metrics when designing experiments that rely on structural information .

How should Rfer_2991 be handled and stored for optimal stability?

Based on established protocols for recombinant membrane proteins, Rfer_2991 requires specific handling conditions to maintain structural integrity and functionality:

  • Storage conditions: Store at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use scenarios .

  • Buffer composition: Typically supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0, or alternatively in Tris-based buffer with 50% glycerol optimized for protein stability .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is standard) for long-term storage

  • Stability considerations: Avoid repeated freeze-thaw cycles; working aliquots can be stored at 4°C for up to one week .

These handling procedures are critical for maintaining protein integrity, especially for membrane proteins that are prone to aggregation and denaturation.

What experimental design considerations are crucial when working with Rfer_2991?

When designing experiments with Rfer_2991, researchers should apply the six key concepts of experimental design while addressing the specific challenges of membrane protein research:

  • Clearly defined variables: Establish distinct independent variables (e.g., buffer conditions, temperature, ligand concentrations) and dependent variables (e.g., binding affinity, structural changes, functional activity) .

  • Appropriate controls: Include both positive controls (well-characterized membrane proteins) and negative controls (non-membrane proteins or buffer-only samples) to validate experimental outcomes .

  • Random assignment: When testing multiple conditions, randomly assign samples to different treatment groups to minimize systematic bias, particularly important in binding studies or functional assays .

  • Environmental consistency: Maintain consistent laboratory conditions to prevent confounding variables from affecting membrane protein stability, which is especially sensitive to temperature and pH fluctuations .

  • Replication strategy: Design with sufficient biological and technical replicates to account for the inherent variability in membrane protein experiments, typically requiring 3-5 independent preparations .

  • Control for confounding variables: Address factors such as detergent concentration, lipid composition, and metal ion presence that specifically affect membrane protein behavior .

For Rfer_2991 specifically, researchers should consider its predicted membrane localization when designing experimental procedures to maintain native-like conditions throughout purification and analysis .

What are the optimal expression and purification strategies for Rfer_2991?

Based on conventional approaches for recombinant membrane proteins similar to Rfer_2991, the following expression and purification strategies are recommended:

Expression System Selection:

  • E. coli-based expression: The documented system for Rfer_2991 is E. coli with an N-terminal His-tag . This system offers cost-effectiveness and scalability, though proper membrane insertion may be challenging.

  • Alternative expression hosts: For improved membrane insertion and post-translational modifications, consider:

    • Insect cell systems (Sf9, High Five)

    • Mammalian expression systems (HEK293, CHO)

    • Cell-free expression systems with supplied lipids or nanodiscs

Purification Protocol Design:

  • Membrane extraction: Use a two-step extraction with mild detergents (e.g., DDM, LMNG, or CHAPS) to solubilize the membrane fraction while preserving protein structure

  • Affinity chromatography: Utilize the N-terminal His-tag with Ni-NTA or TALON resin for initial purification

  • Secondary purification: Apply size exclusion chromatography (SEC) or ion exchange chromatography for higher purity

  • Detergent exchange: Consider exchanging to a more stable detergent or reconstituting into nanodiscs or liposomes for functional studies

Quality Control Checkpoints:

  • SDS-PAGE and Western blot to confirm identity and purity (>90% recommended)

  • Circular dichroism to verify secondary structure integrity

  • Analytical SEC to assess monodispersity

  • Mass spectrometry to confirm exact molecular weight and post-translational modifications

How can researchers effectively study membrane localization and topology of Rfer_2991?

Membrane localization and topology studies for Rfer_2991 require specialized techniques beyond standard protein analysis:

  • Computational prediction validation:

    • Use the AlphaFold structural model (pLDDT 77.4) as a starting point for topology prediction

    • Validate with transmembrane prediction algorithms (TMHMM, Phobius, MEMSAT)

    • Compare predictions with experimental data

  • Experimental topology mapping:

    • Cysteine scanning mutagenesis with membrane-impermeable sulfhydryl reagents

    • Protease protection assays with reconstituted protein

    • Fluorescence-based techniques with strategically placed fluorophores

    • EPR spectroscopy with site-directed spin labeling

  • Cellular localization studies:

    • Confocal microscopy with fluorescently tagged constructs

    • Cell fractionation followed by Western blotting

    • Surface biotinylation assays

    • Proteoliposome reconstitution to assess functional orientation

  • Interaction analysis:

    • Proximity labeling techniques (BioID, APEX)

    • Crosslinking mass spectrometry to identify interaction partners

    • Native mass spectrometry for intact membrane protein complexes

These approaches provide complementary data to build a comprehensive understanding of Rfer_2991's membrane integration and potential functional interactions.

What approaches can be used to determine the function of this uncharacterized membrane protein?

Since Rfer_2991 belongs to the UPF0761 family of uncharacterized membrane proteins, determining its function requires a multi-faceted approach:

  • Comparative genomics analysis:

    • Analyze gene neighborhood in Rhodoferax ferrireducens genome

    • Identify conserved domains across homologous proteins

    • Perform phylogenetic analysis to identify functional clues from evolutionary relationships

  • Structural homology assessment:

    • Use the AlphaFold model (AF-Q21U51-F1) to identify structural homologs through fold comparison

    • Analyze potential binding pockets or functional sites

    • Compare with characterized membrane proteins of similar topology

  • Biochemical characterization:

    • Screen for enzyme activity with various substrates

    • Assess binding to potential ligands using thermal shift assays

    • Perform transport assays if a transporter function is suspected

    • Analyze lipid binding preferences through lipidomic approaches

  • Genetic manipulation studies:

    • Generate knockout or knockdown systems in Rhodoferax ferrireducens

    • Perform complementation studies with mutant variants

    • Utilize heterologous expression to identify phenotypic changes

  • Interaction networks:

    • Identify protein interaction partners through pull-down assays

    • Perform bacterial two-hybrid screening

    • Use proteomics approaches to identify co-regulated proteins

This systematic characterization workflow moves from in silico predictions to in vitro and in vivo validation, providing multiple lines of evidence for functional assignment.

What biophysical techniques are most appropriate for studying Rfer_2991 structure-function relationships?

The structural and functional analysis of Rfer_2991 can be enhanced through these specialized biophysical techniques:

  • Advanced structural analysis:

    • X-ray crystallography (challenging for membrane proteins but provides high resolution)

    • Cryo-electron microscopy (particularly suitable for membrane proteins)

    • Solid-state NMR for studying dynamics in membrane environments

    • Small-angle X-ray scattering (SAXS) for solution conformation

  • Dynamics and conformational studies:

    • Hydrogen-deuterium exchange mass spectrometry

    • FRET-based conformational sensors

    • Molecular dynamics simulations based on the AlphaFold model

    • Single-molecule force spectroscopy

  • Membrane interaction characterization:

    • Neutron reflectometry to determine membrane insertion depth

    • Atomic force microscopy for topography and mechanical properties

    • Fluorescence correlation spectroscopy for diffusion properties

    • Isothermal titration calorimetry for binding energetics

  • Functional assessment techniques:

    • Electrophysiology (patch clamp) if ion channel activity is suspected

    • Fluorescence-based transport assays with reconstituted proteoliposomes

    • Surface plasmon resonance for interaction kinetics

    • Microscale thermophoresis for binding studies

When designing these experiments, researchers should consider the moderate confidence level (pLDDT 77.4) of the available structural model and validate structural predictions experimentally .

How can researchers troubleshoot common issues when working with Rfer_2991?

Membrane proteins like Rfer_2991 present specific challenges that require systematic troubleshooting approaches:

  • Low expression yields:

    • Optimize codon usage for expression host

    • Test different promoter strengths and induction conditions

    • Evaluate alternative expression hosts (yeast, insect cells)

    • Consider fusion partners that enhance membrane protein expression (MBP, SUMO)

  • Protein aggregation:

    • Screen multiple detergents and lipid compositions

    • Optimize buffer conditions (pH, ionic strength, stabilizing additives)

    • Reduce expression temperature to slow folding

    • Add chemical chaperones during expression

  • Purification difficulties:

    • Adjust detergent concentration during extraction and purification

    • Incorporate stabilizing ligands if known

    • Implement gradient elution protocols

    • Consider on-column detergent exchange

  • Functional assay development:

    • Validate protein folding before functional testing

    • Test multiple reconstitution methods (liposomes, nanodiscs)

    • Establish positive controls with related proteins

    • Consider native tissue sources for comparative studies

  • Storage stability issues:

    • Evaluate cryoprotectant additives beyond standard glycerol

    • Test lyophilization with suitable excipients

    • Investigate detergent/lipid mixtures that enhance stability

    • Consider chemical modification approaches to reduce aggregation propensity

These troubleshooting strategies should be implemented systematically, changing one parameter at a time while maintaining appropriate controls.

What data validation strategies should be employed when analyzing Rfer_2991 experimental results?

Ensuring data validity when working with challenging membrane proteins like Rfer_2991 requires rigorous validation strategies:

  • Protein quality assessment:

    • Confirm protein identity through mass spectrometry

    • Verify purity using multiple methods (SDS-PAGE, analytical SEC)

    • Assess homogeneity using dynamic light scattering

    • Validate correct folding through circular dichroism or thermal shift assays

  • Experimental design validation:

    • Apply the principles of randomization and blinding where applicable

    • Include positive and negative controls in every experiment

    • Perform power analysis to determine adequate sample sizes

    • Pre-register experimental protocols when possible

  • Statistical analysis approaches:

    • Apply appropriate statistical tests based on data distribution

    • Control for multiple comparisons when testing numerous conditions

    • Implement mixed-effects models when dealing with batch variations

    • Report effect sizes in addition to p-values

  • Reproducibility considerations:

    • Perform independent biological replicates (minimum n=3)

    • Use different protein preparations to account for batch effects

    • Test critical findings under varying conditions to establish robustness

    • Validate key results using orthogonal methodologies

  • Data reporting standards:

    • Document all experimental conditions comprehensively

    • Report negative and inconsistent results

    • Provide raw data when possible

    • Clearly distinguish between technical and biological replication

These validation strategies align with best practices in experimental research design while addressing the specific challenges of membrane protein biochemistry .

What are the key physical and biochemical properties of Rfer_2991?

For convenient reference, the key properties of Recombinant Rhodoferax ferrireducens UPF0761 membrane protein Rfer_2991 are summarized in the following table:

PropertyValueReference
UniProt IDQ21U51
Source organismRhodoferax ferrireducens T118
Protein length416 amino acids (full length)
Expression systemE. coli
Affinity tagN-terminal His-tag
FormLyophilized powder
Recommended storage-20°C/-80°C
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Alternative storage bufferTris-based buffer with 50% glycerol
Structure modelAlphaFold DB: AF-Q21U51-F1
Model confidence (pLDDT)77.4 (global)
Gene nameRfer_2991
Molecular weight~45 kDa (estimated from sequence)
Purity>90% by SDS-PAGE

This consolidated reference table provides essential information for experimental planning and protocol development when working with Rfer_2991.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.