Recombinant Rhodomonas salina Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please specify it in your order; we will prioritize its use in the production process.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-318
Protein Length
Full Length of Mature Protein
Species
Rhodomonas salina (Cryptomonas salina)
Target Names
petA
Target Protein Sequence
FPVYAQQAYENPREATGRIVCANCHLAQKPVEIEVPQGVLPDTVFEAKVEIPYDLSVKQV TGDGTKGPLNVGAVLILPEGFTLAPKDRLTPEMKEKTKGVVISPYSDSKKSIFVVGPIPG AEHQTIIFPILAPNPADNKNVHFIKYPVFVGANRGRGQVNPTGDKSNNTLYSSPVEGRLT KIEKTEKGGYILTIQSKSGDPLTINVPVGPELVVKEGQKVTADQALTVDPNVGGFGQTET EIVLQSPARVKGLIAFFFTVILAQILLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
Recombinant Rhodomonas salina Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Rhodomonas salina Apocytochrome f (petA) and what is its role in photosynthesis?

Rhodomonas salina Apocytochrome f is a protein encoded by the petA gene in the chloroplast genome of Rhodomonas salina, a marine cryptophyte microalgae. It is a critical component of the cytochrome b6f complex, which plays an essential role in the electron transport chain during photosynthesis. The mature protein spans amino acids 35-318 and has a UniProt ID of A6MVY3 .

Apocytochrome f functions by mediating electron transfer between Photosystem II and Photosystem I. Specifically, it receives electrons from plastoquinol and transfers them to plastocyanin or cytochrome c6. This electron transfer is coupled to proton translocation across the thylakoid membrane, generating a proton gradient that drives ATP synthesis. The process contributes to both linear and cyclic electron flow in photosynthesis, making it essential for understanding photosynthetic efficiency and electron transport mechanisms .

What are the optimal storage conditions for recombinant Rhodomonas salina Apocytochrome f?

Based on technical information, the optimal storage conditions for recombinant Rhodomonas salina Apocytochrome f are:

  • Long-term storage: -20°C to -80°C in aliquots to minimize freeze-thaw cycles

  • Short-term storage (up to one week): 4°C

  • Storage buffer: Tris-based buffer with pH 8.0, containing approximately 50% glycerol

  • For lyophilized preparations: reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

It is strongly recommended to avoid repeated freeze-thaw cycles as they can compromise protein integrity and activity . Working aliquots should be prepared during the initial thawing to minimize the need for repeated freezing and thawing of the stock solution. The recommended buffer system typically includes 6% trehalose for lyophilized forms, which helps maintain protein stability during freeze-drying and subsequent reconstitution .

What is the significance of studying Rhodomonas salina in photosynthesis research?

Rhodomonas salina is a valuable model organism for photosynthesis research for several reasons:

  • As a cryptophyte, it represents a distinct evolutionary lineage with unique photosynthetic adaptations

  • It contains both chlorophyll a and phycoerythrin as photosynthetic pigments, allowing for research on diverse light-harvesting systems

  • It demonstrates significant adaptation capabilities to different environmental conditions, including temperature, pH, and light intensity

  • Its growth conditions can be optimized to enhance biomass and photosynthetic pigment production

Studies have shown that Rhodomonas salina exhibits temperature-dependent changes in cell size and pigment composition. At lower temperatures (5°C), cells are larger (up to 341 μm³) compared to higher temperatures (20°C, around 110 μm³) . The phycoerythrin to chlorophyll a ratio also varies with environmental conditions, which provides insights into photosynthetic adaptation mechanisms .

How do environmental factors affect the expression and function of petA gene products in Rhodomonas salina?

The expression and function of petA gene products in Rhodomonas salina are influenced by multiple environmental factors:

Environmental FactorEffect on Expression/FunctionObservable Parameters
Light IntensityAffects photosynthetic efficiency and gene expressionGrowth rate, phycoerythrin/chl a ratio
TemperatureSignificant impact on cell size and metabolismCell volume, growth rate
pHAffects growth and protein stabilityBiomass production, photosynthetic efficiency

Research indicates that Rhodomonas salina grows optimally at temperatures around 20°C, with growth rates decreasing significantly at lower temperatures (5°C) . The light saturation constant (Ek) and maximum photosynthesis rate also vary with temperature, suggesting temperature-dependent regulation of photosynthetic machinery, including cytochrome components .

pH optimization studies have shown that Rhodomonas salina achieves its highest efficiency under controlled pH conditions around 8.5 . This suggests that the function of membrane proteins like Apocytochrome f may be pH-sensitive, affecting electron transport chain efficiency under different pH environments.

What are the structural differences between native and recombinant Rhodomonas salina Apocytochrome f?

Comparing native and recombinant Rhodomonas salina Apocytochrome f reveals several important structural differences:

  • Post-translational modifications:

    • Native protein may contain modifications absent in recombinant versions

    • These may include specific glycosylation patterns and oxidation states

  • N-terminal processing:

    • Native protein undergoes natural signal peptide cleavage

    • Recombinant protein typically includes artificial tags (e.g., His-tag)

  • Folding variations:

    • Recombinant protein expressed in E. coli may have different folding kinetics

    • Differences in disulfide bond formation may occur due to different redox environments

  • Heme incorporation:

    • Native protein has co-translational heme incorporation

    • Recombinant protein may require in vitro heme reconstitution

The recombinant protein is typically expressed with a His-tag at the N-terminus, which facilitates purification but may affect the protein's structural properties . The mature native protein spans amino acids 35-318, with the first 34 amino acids representing a signal peptide that is cleaved during natural processing .

How can protein tagging affect the functionality of recombinant Rhodomonas salina Apocytochrome f?

Protein tagging, particularly the addition of His-tags for purification purposes, can impact the functionality of recombinant Rhodomonas salina Apocytochrome f in several ways:

Commercial preparations of recombinant Rhodomonas salina Apocytochrome f typically include an N-terminal His-tag . While this facilitates purification, researchers should consider the potential impact on functionality when designing experiments with these recombinant proteins.

What spectroscopic methods are most effective for analyzing recombinant Apocytochrome f structure and function?

Several spectroscopic methods provide valuable information about recombinant Apocytochrome f structure and function:

  • UV-visible absorption spectroscopy:

    • Primary method for characterizing heme proteins

    • Monitors the Soret band (~420 nm) and α/β bands (520-550 nm)

    • Can track redox state changes and ligand binding

    • Quantitative determination of heme incorporation

  • Circular dichroism (CD) spectroscopy:

    • Assessment of secondary structure elements

    • Far-UV region (190-250 nm) for protein backbone

    • Near-UV region (250-350 nm) for tertiary structure fingerprint

    • Thermal stability monitoring through melting curves

  • Resonance Raman spectroscopy:

    • Selective enhancement of heme vibrations

    • Information about heme coordination and spin state

    • Detection of subtle structural changes upon mutation

For Rhodomonas salina specifically, researchers have used spectroscopic methods to characterize photosynthetic pigments, including chlorophyll a and phycoerythrin, which interact with the electron transport chain components like Apocytochrome f . The phycoerythrin to chlorophyll a ratio can be measured spectroscopically and varies with growth conditions , potentially affecting the interaction environment of Apocytochrome f.

How can mutation studies of recombinant Apocytochrome f provide insights into electron transport chains?

Mutation studies of recombinant Apocytochrome f offer valuable insights into electron transport mechanisms:

  • Critical residue identification:

    • Site-directed mutagenesis of conserved residues

    • Heme-coordinating residues (e.g., histidines)

    • Surface-exposed residues involved in protein-protein interactions

  • Electron transfer pathway mapping:

    • Mutations along predicted electron transfer paths

    • Assessment of electron transfer rates using laser flash photolysis

    • Correlation between structural position and functional impact

  • Redox potential modulation:

    • Mutations affecting the microenvironment of the heme group

    • Measurement of altered redox potentials using potentiometric titrations

    • Structure-function relationships in electron transfer efficiency

For Rhodomonas salina specifically, the unique evolutionary position of this cryptophyte species makes comparative mutation studies particularly valuable. By comparing the effects of equivalent mutations in Apocytochrome f from different photosynthetic organisms, researchers can gain insights into the evolution and adaptation of photosynthetic electron transport chains across diverse taxonomic groups .

What are the optimal conditions for culturing Rhodomonas salina to study photosynthetic proteins?

Optimizing culture conditions for Rhodomonas salina requires careful consideration of multiple parameters:

ParameterOptimal ConditionEffect on Growth/Protein Expression
Temperature20°CHighest growth rate (0.24 d⁻¹)
Light Intensity60-150 μmol photons m⁻² s⁻¹Optimal photosynthetic efficiency
pH7.0-8.5Maximum biomass production
Mediaf/2 medium with added nutrientsEnhanced growth
CO₂ supplementation5% CO₂ v/v in airImproved carbon fixation

Research has demonstrated that Rhodomonas salina exhibits temperature-dependent growth, with maximum rates observed at 20°C . The cell size decreases significantly with increasing temperature, from approximately 341 μm³ at 5°C to 110 μm³ at 20°C .

Light intensity significantly affects photosynthetic pigment composition. The phycoerythrin to chlorophyll a ratio varies with light conditions, potentially affecting the expression and function of electron transport components like Apocytochrome f .

For optimal growth, Rhodomonas salina should be maintained in pre-sterilized (20 min at 120°C) containers in filtered (0.2 μm pore size) f/2 medium with a salinity of 30 g L⁻¹ . Continuous illumination at appropriate light intensities and temperature control at 20 ± 1°C provide ideal conditions for studying photosynthetic proteins .

How can we assess the functionality of recombinant Apocytochrome f in vitro?

Assessing the functionality of recombinant Apocytochrome f requires multiple complementary approaches:

  • Spectroscopic characterization:

    • UV-visible absorption spectroscopy to confirm proper heme incorporation

    • Characteristic peaks at approximately 420 nm (Soret band) and 520-550 nm (α and β bands)

    • Reduced vs. oxidized spectra comparison to confirm redox activity

  • Redox potential determination:

    • Potentiometric titrations using reference electrodes

    • Spectroelectrochemical methods to monitor redox transitions

    • Comparison with native protein redox potentials

  • Electron transfer kinetics:

    • Laser flash photolysis to measure electron transfer rates

    • Stopped-flow spectroscopy for rapid kinetic measurements

    • Temperature dependence studies to determine activation parameters

  • Protein-protein interaction studies:

    • Surface plasmon resonance (SPR) with physiological partners

    • Isothermal titration calorimetry (ITC) for binding thermodynamics

    • Biolayer interferometry for real-time binding kinetics

A comprehensive functionality assessment would include initial spectroscopic characterization to confirm heme incorporation, followed by redox potential measurements under physiological conditions, and finally kinetic analysis of electron transfer with natural electron donors/acceptors.

What approaches can be used to optimize the expression of recombinant Rhodomonas salina Apocytochrome f?

Optimizing the expression of recombinant Rhodomonas salina Apocytochrome f requires systematic investigation of multiple parameters:

  • Expression system selection:

    • E. coli is the most common host for recombinant Apocytochrome f expression

    • BL21(DE3) or Rosetta strains may be particularly suitable for membrane proteins

    • Consideration of alternative expression systems for difficult proteins

  • Vector design:

    • Optimization of codon usage for the expression host

    • Selection of appropriate promoters (e.g., T7 for E. coli)

    • Inclusion of purification tags (His-tag is commonly used)

  • Expression conditions:

    • Induction temperature (typically lower temperatures favor proper folding)

    • Inducer concentration optimization

    • Duration of expression

    • Media composition

  • Purification strategy optimization:

    • Buffer composition for optimal stability

    • Detergent selection for membrane protein solubilization

    • Purification steps to achieve >90% purity

For recombinant Rhodomonas salina Apocytochrome f specifically, expression in E. coli with an N-terminal His-tag has been successfully demonstrated . The protein is typically purified to >90% purity and can be stored in a Tris-based buffer with pH 8.0, containing approximately 50% glycerol for stability .

How can protein engineering be used to enhance the stability of recombinant Apocytochrome f?

Several protein engineering approaches can enhance the stability of recombinant Apocytochrome f:

  • Surface residue modification:

    • Replacement of exposed hydrophobic residues with hydrophilic ones

    • Introduction of salt bridges to enhance structural stability

    • Elimination of surface-exposed cysteine residues to prevent unwanted disulfide formation

  • Thermal stability enhancement:

    • Introduction of proline residues in loop regions

    • Addition of disulfide bridges at strategic locations

    • Optimization of hydrogen bonding networks

  • Solubility improvement:

    • Fusion with solubility-enhancing tags (e.g., MBP, SUMO)

    • Surface charge engineering to increase electrostatic repulsion

    • Reduction of hydrophobic patches on the protein surface

  • Storage stability enhancement:

    • Addition of stabilizing agents in storage buffers (e.g., trehalose)

    • Optimization of pH and ionic strength

    • Consideration of lyophilization for long-term storage

For recombinant Rhodomonas salina Apocytochrome f specifically, the addition of 6% trehalose to the storage buffer has been shown to improve stability during lyophilization and subsequent reconstitution . Storage in 50% glycerol and aliquoting to avoid freeze-thaw cycles further enhances long-term stability .

What experimental controls are essential when working with recombinant Apocytochrome f?

Several critical controls should be included in experiments involving recombinant Apocytochrome f:

  • Protein quality controls:

    • SDS-PAGE to verify protein purity and integrity

    • Mass spectrometry to confirm protein identity

    • Circular dichroism to verify proper folding

    • Heme content determination to assess cofactor incorporation

  • Activity controls:

    • Positive control using native or well-characterized recombinant protein

    • Negative control using denatured or heme-depleted protein

    • Concentration-dependent activity measurements

    • Temperature and pH controls to ensure optimal conditions

  • Specificity controls:

    • Mutated variants with known effects on function

    • Competition assays with natural substrates or inhibitors

    • Assays with non-physiological partners to assess specificity

    • Tag-only controls to assess tag effects on observed activities

  • Environmental controls:

    • Buffer composition controls (pH, ionic strength)

    • Redox state controls using reducing or oxidizing agents

    • Temperature controls during activity measurements

    • Light exposure controls for photosensitive measurements

Including these controls ensures experimental reproducibility and facilitates the interpretation of results, particularly when comparing different preparations of recombinant Apocytochrome f or when assessing the effects of experimental manipulations on protein function.

How do you compare kinetic parameters between native and recombinant Apocytochrome f?

Comparing kinetic parameters between native and recombinant Apocytochrome f requires rigorous methodological approaches:

  • Electron transfer rate determination:

    • Laser flash photolysis measurements

    • Stopped-flow spectroscopy

    • Derivation of pseudo-first-order or second-order rate constants

    • Statistical comparison of rate constants using t-tests or ANOVA

  • Steady-state enzyme kinetics:

    • Determination of kcat and Km values using various substrates

    • Lineweaver-Burk or Eadie-Hofstee plots for parameter extraction

    • Calculation of catalytic efficiency (kcat/Km)

    • Analysis of variance to assess statistical significance of differences

  • Redox potential comparisons:

    • Potentiometric titrations under identical conditions

    • Nernst equation analysis for midpoint potential determination

    • Statistical evaluation of repeatability and significance of differences

A systematic comparative approach includes ensuring comparable protein preparations (purity, concentration, activity), using identical experimental conditions for both protein forms, performing sufficient technical and biological replicates (n≥3), and applying appropriate statistical tests with consideration of sample size.

What are the best practices for normalizing data when comparing different preparations of recombinant Apocytochrome f?

Proper normalization is critical when comparing different preparations of recombinant Apocytochrome f:

  • Protein concentration normalization:

    • Accurate protein quantification using multiple methods (Bradford, BCA, absorbance at 280 nm)

    • Correction for different extinction coefficients if tags or mutations alter absorbance

    • Consideration of purity differences between preparations

    • Expression of activity per unit protein (specific activity)

  • Heme content normalization:

    • Quantification of heme incorporation through spectroscopic methods

    • Calculation of heme:protein ratio for each preparation

    • Expression of activity per mole of incorporated heme

    • Adjustment for varying degrees of heme incorporation

  • Activity reference standards:

    • Inclusion of internal standards across experiments

    • Use of relative activity units compared to a reference preparation

    • Calibration curves with known activity standards

    • Regular validation of reference standards for consistency

  • Environmental factor normalization:

    • Temperature correction using Arrhenius relationships

    • pH standardization or construction of pH-activity profiles

    • Ionic strength adjustments for comparable conditions

    • Correction for differences in redox potential of measurement systems

Best practices include documentation of all normalization steps and rationales, validation of normalization methods using controls, assessment of normalization impact on data variability, and transparency in reporting both raw and normalized data.

How can environmental parameters be integrated into analyses of Apocytochrome f function?

Environmental parameters significantly influence Apocytochrome f function and should be integrated into analyses:

  • Temperature effects:

    • Rhodomonas salina shows temperature-dependent growth (optimal at 20°C)

    • Cell size decreases with increasing temperature (341 μm³ at 5°C to 110 μm³ at 20°C)

    • Enzyme kinetics vary with temperature according to Arrhenius relationships

    • Activation energy determination through temperature-dependent activity measurements

  • Light intensity considerations:

    • Photosynthetic pigment composition varies with light intensity

    • Phycoerythrin to chlorophyll a ratio is affected by light conditions

    • Light-dependent electron transport rates must be normalized to light intensity

    • Light saturation curves provide parameters for cross-experimental comparisons

  • pH effects:

    • Growth and protein function optimized at specific pH values (7.0-8.5)

    • Protonation states of key residues affect electron transfer capabilities

    • pH-activity profiles should be established for proper normalization

    • Buffer composition influences pH stability during measurements

  • Integrated analysis approaches:

    • Multiple regression models incorporating environmental parameters

    • Principal component analysis to identify major contributing factors

    • Response surface methodology for optimizing multiple parameters simultaneously

    • Experimental design to minimize confounding environmental effects

For Rhodomonas salina specifically, studies have demonstrated that temperature significantly affects cell size and growth rate, while light intensity influences pigment composition . These factors should be carefully controlled and documented in experimental designs, and their effects should be integrated into data analysis frameworks.

How do you analyze and interpret spectroscopic data for recombinant Apocytochrome f?

Analyzing spectroscopic data for recombinant Apocytochrome f requires specific approaches:

  • UV-visible absorption spectra:

    • Baseline correction and normalization procedures

    • Deconvolution of overlapping spectral features

    • Difference spectroscopy to detect subtle changes

    • Quantitative analysis of peak positions, intensities, and ratios

  • Circular dichroism (CD) data:

    • Conversion of raw data to mean residue ellipticity

    • Secondary structure estimation using reference datasets

    • Thermal stability assessment through melting curve analysis

    • Comparison of spectra between different protein preparations

  • Redox titration data:

    • Fitting to the Nernst equation to determine midpoint potentials

    • Analysis of n-values for electron transfer processes

    • Evaluation of cooperativity in multi-electron processes

    • Error analysis and confidence interval determination

  • Time-resolved spectroscopy:

    • Kinetic model fitting to transient absorption data

    • Global analysis of multi-wavelength datasets

    • Extraction of rate constants and amplitudes

    • Arrhenius analysis for temperature-dependent measurements

When analyzing spectroscopic data from Rhodomonas salina Apocytochrome f, researchers should consider the spectral properties of photosynthetic pigments that may be co-extracted or interact with the protein. For example, phycoerythrin has distinctive spectral features that may overlap with cytochrome signals .

How do you reconcile contradictory findings about Apocytochrome f function in the literature?

Addressing contradictory findings about Apocytochrome f function requires a systematic approach:

  • Methodological differences assessment:

    • Detailed comparison of experimental protocols

    • Evaluation of protein preparation methods (expression systems, purification strategies)

    • Analysis of assay conditions (temperature, pH, buffer composition)

    • Consideration of detection methods and their limitations

  • Sample-related factors:

    • Differences in protein constructs (full-length vs. truncated, tag position)

    • Variation in post-translational modifications

    • Assessment of protein quality and stability

    • Consideration of storage conditions and age of preparations

  • Data analysis approaches:

    • Reanalysis of raw data using consistent statistical methods

    • Meta-analysis of multiple studies when sufficient data is available

    • Assessment of statistical power and sample sizes

    • Evaluation of outlier handling and exclusion criteria

  • Biological variability factors:

    • Species-specific differences in Apocytochrome f properties

    • Environmental adaptation leading to functional variations

    • Physiological context of the studied systems

    • Interaction with different partners depending on the system

A systematic reconciliation approach includes creating a comprehensive table comparing methodologies and findings, identifying key variables that could explain discrepancies, designing critical experiments to test competing hypotheses, and developing a consensus framework highlighting context-dependent functionality.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.