Recombinant Rhodomonas salina ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Rhodomonas salina (Cryptomonas salina)
Target Names
atpF
Target Protein Sequence
MNDFLLISSLAELSSETKKSFGFNPNFLEANVLNIAILLSGVVYLGRNFLTSALEVRQQK VAEAIQEAEERLVQANSRLLESEKQLTQAQAVIEEIKKEAEKTARTVKESILAQGKLDIE RLTNNGKSSIEKAELQIKKQIQQHITELAIQKVTVQLKEYMTPNLQSKVIDSNISNLGGQ L
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembrane catalytic core; and F0, the membrane proton channel. These are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via the rotary mechanism of the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Recombinant Rhodomonas salina ATP synthase subunit b, chloroplastic (atpF)?

Recombinant Rhodomonas salina ATP synthase subunit b, chloroplastic (atpF) is a protein component of the chloroplastic ATP synthase complex in the cryptophyte Rhodomonas salina. This protein is part of the F0 sector of ATP synthase, functioning in the membrane-bound portion that facilitates proton translocation across the thylakoid membrane. The protein has been expressed recombinantly, typically in E. coli expression systems, to enable detailed biochemical and structural studies. The protein has alternative designations including ATP synthase F(0) sector subunit b and ATPase subunit I .

How does ATP synthase function in cryptophyte chloroplasts compared to other photosynthetic organisms?

ATP synthase in cryptophyte chloroplasts functions within a unique photosynthetic apparatus. Unlike cyanobacteria and red algae that have organized phycobilisomes, cryptophytes like Rhodomonas salina have atypical phycobiliproteins with no observed organization. They employ only one antenna protein, either phycoerythrin or phycocyanin, which is immobile and located at the luminal side of the thylakoid membrane . In addition, cryptophytes have membrane-bound chlorophyll a/c antenna systems. This distinct arrangement affects how light energy is captured and ultimately converted to chemical energy via ATP synthase. The ATP synthase complex utilizes the proton gradient established across the thylakoid membrane during photosynthesis to synthesize ATP, providing energy for cellular processes.

What are the optimal storage conditions for Recombinant Rhodomonas salina ATP synthase subunit b?

The optimal storage conditions for Recombinant Rhodomonas salina ATP synthase subunit b (atpF) are:

Storage PurposeTemperatureDurationNotes
Regular storage-20°CMonthsIn buffer with 50% glycerol
Extended storage-80°CYearsAliquot before freezing
Working aliquots4°CUp to one weekAfter thawing

Repeated freezing and thawing cycles are not recommended as they can lead to protein degradation and loss of activity. The protein is typically supplied in a Tris-based buffer containing 50% glycerol optimized for protein stability .

What expression systems are most effective for producing Recombinant Rhodomonas salina ATP synthase subunit b?

E. coli is the preferred expression host for Recombinant Rhodomonas salina ATP synthase subunit b (atpF) . When designing an expression system, researchers should consider:

  • Codon optimization: Adjust codons to match E. coli preferences

  • Affinity tags: Include appropriate tags (His, GST, etc.) to facilitate purification

  • Expression conditions: Optimize temperature, IPTG concentration, and induction time

  • Solubility enhancements: Consider fusion partners or chaperone co-expression for improved solubility

  • Signal sequences: Remove chloroplast transit peptides if present for improved expression

For membrane proteins like ATP synthase components, expression in specialized E. coli strains such as C41(DE3) or C43(DE3) may improve yields by accommodating membrane protein overexpression.

How can I verify the functional activity of Recombinant Rhodomonas salina ATP synthase subunit b?

Verifying the functional activity of Recombinant Rhodomonas salina ATP synthase subunit b requires assessing its ability to properly integrate into the ATP synthase complex and support ATP synthesis. Consider these methodological approaches:

  • Reconstitution assays: Incorporate the recombinant atpF into liposomes with other ATP synthase subunits

  • ATP hydrolysis/synthesis measurement: Quantify ATP hydrolysis/synthesis rates using:

    • Spectrophotometric coupled enzyme assays (NADH oxidation)

    • Luciferase-based ATP detection

    • 32P-ATP incorporation assays

  • Proton translocation assays: Measure proton movement using pH-sensitive fluorescent dyes

  • Binding partner analysis: Perform pulldown assays with known interaction partners

  • Structural integrity assessment: Use circular dichroism spectroscopy to confirm proper secondary structure

These functional analyses should be performed in comparison to established controls to validate activity.

How does light quality affect the expression and activity of ATP synthase in Rhodomonas salina?

Light quality has significant effects on ATP synthase expression and activity in Rhodomonas salina, directly influencing photosynthetic efficiency and energy production:

  • Green light effects: Growth under green light results in higher biomass productivity due to more efficient photosynthetically usable radiation absorption . This leads to:

    • Increased protein content, including photosynthetic machinery

    • Higher rates of ATP synthesis

    • Enhanced metabolic activity

  • Red light effects: Cultivation under red light:

    • Stimulates phycoerythrin (PE) synthesis

    • Results in higher carbohydrate content

    • Potentially alters the stoichiometry of ATP synthase components

  • Blue light effects: Similar to red light, blue light cultivation results in:

    • Higher carbohydrate accumulation

    • Modified photosynthetic apparatus composition

    • Altered ATP synthase activity

Light quality influences not only the expression levels of ATP synthase components but potentially their assembly and functional efficiency within the thylakoid membrane .

What is the relationship between ATP synthase function and phycoerythrin production in Rhodomonas salina?

The relationship between ATP synthase function and phycoerythrin (PE) production in Rhodomonas salina involves complex metabolic and energetic interactions:

ATP synthase function and PE production are therefore interdependent processes, with ATP synthase providing the energy currency necessary for PE synthesis while PE contributes to the proton gradient that drives ATP synthase activity.

How do mutations in atpF affect the assembly and function of the ATP synthase complex?

Mutations in the atpF gene encoding ATP synthase subunit b can have various effects on complex assembly and function:

Mutation RegionImpact on AssemblyImpact on FunctionDetection Methods
N-terminal membrane domainDisrupted membrane integrationCompromised proton translocationBlue native PAGE, immunoblotting
Central regionAltered interactions with other F0 subunitsReduced complex stabilityAffinity purification, sucrose gradient centrifugation
C-terminal domainImpaired connection to F1 sectorUncoupled ATP synthesisATP synthesis/hydrolysis assays

Key experimental approaches to study these effects include:

  • Site-directed mutagenesis: Generate specific point mutations in conserved residues

  • Complementation studies: Express mutated atpF in knockout strains

  • Structural analysis: Use cryo-EM or X-ray crystallography to determine structural changes

  • Bioenergetic measurements: Assess proton motive force and ATP synthesis rates

  • Protein-protein interaction analysis: Employ crosslinking and mass spectrometry to map interaction interfaces

How does Rhodomonas salina ATP synthase subunit b differ from ATP synthase subunit b'?

Rhodomonas salina contains both ATP synthase subunit b (atpF) and subunit b' (atpG), which have distinct structures and functions within the ATP synthase complex:

FeatureATP synthase subunit b (atpF)ATP synthase subunit b' (atpG)
Length181 amino acids155 amino acids
SequenceMNDFLLISSLAELSSETKKSFGFNPNFLEANVLNIAILLSGVVYLGRNFLTSALEVRQQKVAEAIQEAEERLVQANSRLLESEKQLTQAQAVIEEIKKEAEKTARTVKESILAQGKLDIEERLTNNGKSSIEKAELQIKKQIQQHITELAIQKVTVQLKEYMTPNLQSKVIDSNISNLGGQLMTNSLFLLAEGGLFDFNATLPLMVLQILLLMVVLNAIFYTPIARVLDERDEYIRKNLTQASETLAKAEAITKQYEQDLAKERRDAQMIIASSQQEAQEIVAMEIKQAQKDTELLVNEATTQLNSQKEKALQALEKQVNTLSEQIKNKLLSGQLAG
UniProt IDA6MVW6A6MVW7
Alternative namesATP synthase F(0) sector subunit b, ATPase subunit IATP synthase F(0) sector subunit b', ATPase subunit II

While both proteins are part of the F0 sector, they have distinct roles in the structural organization of the ATP synthase complex. The heterodimeric b-b' stator plays a critical role in connecting the membrane-embedded F0 sector with the catalytic F1 sector. The evolutionary divergence of these two subunits reflects adaptations in the ATP synthase architecture specific to cryptophytes and their endosymbiotic history .

What unique features does Rhodomonas salina ATP synthase possess compared to other algal species?

Rhodomonas salina ATP synthase possesses several unique features compared to other algal species:

  • Evolutionary origin: As a cryptophyte, Rhodomonas salina has a complex evolutionary history involving secondary endosymbiosis, resulting in a chimeric ATP synthase with components from different evolutionary origins.

  • Phycobiliprotein interaction: Unlike other algae, the ATP synthase operates in an environment with atypical, non-organized phycobiliproteins that are immobile and located at the luminal side of the thylakoid membrane .

  • Membrane environment: The thylakoid membranes of Rhodomonas salina have a distinct lipid composition, which affects ATP synthase function and stability.

  • Regulatory adaptations: Rhodomonas salina has evolved specific regulatory mechanisms to coordinate ATP synthase activity with its unique light-harvesting system involving both chlorophyll a/c and phycoerythrin.

  • Environmental adaptations: The ATP synthase complex has specialized features that enable Rhodomonas salina to thrive in specific niches, contributing to its importance in aquaculture applications.

These distinctive features make Rhodomonas salina ATP synthase an interesting subject for comparative bioenergetic studies across algal lineages.

What are common challenges in expressing Recombinant Rhodomonas salina ATP synthase subunit b?

Researchers frequently encounter several challenges when expressing Recombinant Rhodomonas salina ATP synthase subunit b:

  • Membrane protein expression issues: As a membrane protein component, atpF can be difficult to express in soluble form. Solutions include:

    • Optimization of detergent types and concentrations

    • Expression as fusion proteins with solubility-enhancing tags

    • Use of specialized E. coli strains designed for membrane protein expression

  • Protein folding problems: Incorrect folding can lead to inclusion body formation. Strategies to address this include:

    • Lower induction temperatures (16-20°C)

    • Reduced IPTG concentrations

    • Co-expression with molecular chaperones

  • Toxicity to host cells: Overexpression may be toxic to E. coli. Consider:

    • Tightly regulated promoter systems

    • Host strains with enhanced membrane capacity

    • Lower copy number plasmids

  • Purification challenges: Extraction and purification while maintaining native structure requires:

    • Careful optimization of detergent conditions

    • Gentle solubilization procedures

    • Avoiding repeated freeze-thaw cycles during storage

  • Functional validation: Confirming proper activity is challenging since the protein functions as part of a complex. Approaches include:

    • Reconstitution with partner proteins

    • Structure-based assays

    • Complementation studies in mutant systems

How can researchers assess the proper folding of Recombinant Rhodomonas salina ATP synthase subunit b?

Assessing the proper folding of Recombinant Rhodomonas salina ATP synthase subunit b requires multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure content

    • Fluorescence spectroscopy to assess tertiary structure

    • Dynamic light scattering to evaluate homogeneity

    • Thermal shift assays to determine stability

  • Functional assessment:

    • Binding assays with known interaction partners

    • Activity measurements when incorporated into ATP synthase complexes

    • Proton translocation capacity in reconstituted systems

  • Structural validation:

    • Limited proteolysis to probe for properly folded domains

    • NMR spectroscopy for structural determination

    • Cryo-EM analysis when assembled with partner proteins

  • Quality control methods:

    • Size exclusion chromatography to evaluate oligomeric state

    • Native PAGE to assess complex formation

    • Mass spectrometry to confirm intact protein

When storing the protein, researchers should maintain it in a Tris-based buffer with 50% glycerol at -20°C for regular storage or -80°C for extended storage . Working aliquots should be kept at 4°C for no more than one week to preserve structural integrity.

What experimental approaches can reveal the role of ATP synthase in Rhodomonas salina stress responses?

To investigate the role of ATP synthase in Rhodomonas salina stress responses, researchers can employ these experimental approaches:

  • Transcriptomic analysis:

    • RNA-seq under various stress conditions (nitrogen starvation, light stress, salinity)

    • qRT-PCR targeting ATP synthase genes

    • Time-course analysis to capture dynamic responses

  • Proteomic studies:

    • Quantitative proteomics comparing stress vs. control conditions

    • Phosphoproteomics to identify regulatory modifications

    • Blue native PAGE to assess ATP synthase complex integrity

  • Physiological measurements:

    • Oxygen evolution rates

    • ATP/ADP ratio determination

    • Membrane potential measurements using fluorescent probes

    • Growth rate and biomass productivity under stress conditions

  • Genetic manipulation:

    • RNAi or CRISPR-based knockdown/knockout of ATP synthase components

    • Overexpression studies

    • Site-directed mutagenesis of key residues

  • Environmental manipulation experiments:

    • Light quality/quantity variation (green vs. red/blue)

    • Nitrogen starvation conditions, which can trigger fatty acid accumulation

    • pH manipulation (shown to affect biomass productivity)

    • Salinity stress response evaluation

These approaches should be combined in an integrated experimental design to provide comprehensive insights into how ATP synthase function is modulated during stress responses in Rhodomonas salina.

How can researchers optimize Rhodomonas salina cultivation for ATP synthase production?

Optimizing Rhodomonas salina cultivation for ATP synthase production requires careful control of multiple parameters:

ParameterOptimal ConditionEffect on ATP SynthaseMonitoring Method
Light qualityGreen light for biomass, red light for specific componentsHigher protein content under green lightPAM fluorometry, spectral analysis
Light intensity100-150 μmol photons m⁻² s⁻¹Balanced photosynthesis without photoinhibitionQuantum yield measurements
Nitrogen availabilityNitrogen-replete conditionsHigher protein synthesis capacityNitrate/ammonium measurements
pH7.5-8.0Optimal for biomass productivityContinuous pH monitoring
SalinitySpecies-dependent, typically 20-30 pptAffects membrane compositionConductivity measurements
Temperature18-22°COptimal enzyme activityTemperature logging
Culture modeContinuous or semi-continuousConsistent protein qualityBiomass monitoring

Research has shown that Rhodomonas salina demonstrates higher biomass productivity when cultivated under green light illumination due to higher photosynthetically usable radiation . This condition promotes higher protein content, which would benefit ATP synthase production. For large-scale cultivation, tubular photobioreactors under controlled pH conditions have been successfully employed for Rhodomonas production .

What emerging technologies could advance our understanding of Rhodomonas salina ATP synthase function?

Several emerging technologies hold promise for deepening our understanding of Rhodomonas salina ATP synthase function:

  • Cryo-electron microscopy advances:

    • High-resolution structural determination of the complete ATP synthase complex

    • Visualization of conformational changes during catalytic cycles

    • Identification of species-specific structural adaptations

  • Single-molecule techniques:

    • FRET-based approaches to monitor rotational dynamics

    • Optical tweezers to measure torque generation

    • Nanodiscs for studying ATP synthase in defined membrane environments

  • Advanced genetic tools:

    • CRISPR-Cas9 genome editing for Rhodomonas salina

    • Inducible gene expression systems

    • Site-specific incorporation of unnatural amino acids for specialized studies

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Flux balance analysis of energy metabolism

    • Mathematical modeling of ATP synthase operation under varying conditions

  • Microfluidic technologies:

    • High-throughput screening of culture conditions

    • Single-cell analysis of ATP synthase expression

    • Controlled gradients for studying environmental adaptation

These technologies, when applied to Rhodomonas salina research, could reveal unique adaptations of its ATP synthase to the cryptophyte lifestyle and specialized ecological niches.

How might understanding Rhodomonas salina ATP synthase inform bioenergetic applications?

Understanding Rhodomonas salina ATP synthase could inform several bioenergetic applications:

  • Bioinspired energy conversion systems:

    • Design of artificial photosynthetic systems based on cryptophyte energy transfer mechanisms

    • Development of biomimetic rotary motors inspired by ATP synthase function

    • Creation of nanoscale energy conversion devices

  • Enhanced algal bioproduction:

    • Optimization of light harvesting and energy conversion for biofuel production

    • Genetic engineering of ATP synthase for improved photosynthetic efficiency

    • Development of stress-resistant algal strains with modified bioenergetics

  • Aquaculture applications:

    • Improving nutritional value of Rhodomonas salina through enhanced fatty acid production

    • Optimizing cultivation conditions for maximum phycoerythrin production

    • Development of specialized feeds with tailored bioenergetic properties

  • Pharmaceutical relevance:

    • ATP synthase as a target for antimicrobial compounds

    • Structure-based drug design utilizing unique features of cryptophyte ATP synthase

    • Development of inhibitors or modulators with specificity for certain algal groups

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.