Recombinant Rhodomonas salina Cytochrome c biogenesis protein ccs1 (ccs1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please specify this during your order to prioritize its inclusion in the production process.
Synonyms
ccs1; Cytochrome c biogenesis protein Ccs1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-441
Protein Length
full length protein
Species
Rhodomonas salina (Cryptomonas salina)
Target Names
ccs1
Target Protein Sequence
MLIKINQYFRKSISVLGNLKLAIILLLMLALFSAFGTVIEQNQNVAFYENSYPNSAPLFG FLSANAILFLGLNNIYQTWWFTTLILLLAVSLFSCTLARQIPSLKMARLWQFYTKDQSLK KIGLSFNLQKTSLSKLAFTLKTDDYNVIQKGRFLYAYKGLPGKIGPIIVHASLIIILFGA LLGNLSGFVSQELVPLGGVFHIQNIINSGTLSYVPQNFEGYVKDFKIAYNDEGSIDQFYS DLSILNSTGEEVRSKTIYVNEPLRYEGIVFYQTDWSITNLAINVDQQTNIQLPLKSINVK GEGKFWIASLPIANVEKATNDNILLVLEDLTGKILLYSSNQQLLAIVNVGENISLNGHSV KVTDIISSTGLQIKSDPGIPFVYIGFFLLMLSITLSYFSYSQVWAIKDNKTLYVSGRTNR AIYSFEQQITKMMNKLNSTYA
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically in the heme attachment step.
Protein Families
Ccs1/CcsB family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does R. salina ccs1 compare to cytochrome c biogenesis proteins in other organisms?

R. salina ccs1 is part of the broader family of cytochrome c biogenesis proteins, which are categorized into different systems (System I, II, III, IV, and V). While Rhodomonas belongs to cryptophytes, its cytochrome c biogenesis system shares functional similarities with other organisms:

  • System I (Ccm): Found in Gram-negative bacteria, archaea, and plant mitochondria

  • System II: Present in Gram-positive bacteria, cyanobacteria, and chloroplasts

  • System III: In mitochondria of fungi, metazoans, and some protists

  • Systems IV and V: In other specialized organisms

R. salina ccs1 likely participates in one of these systems, with structural and functional homology to other cytochrome c biogenesis proteins. The protein's role would involve facilitating the stereo-specific thioether bond formation between heme b vinyls and the cysteines in the CXXCH motif of apocytochromes .

What are the optimal conditions for expressing recombinant R. salina ccs1 protein?

The recombinant full-length R. salina ccs1 protein is typically expressed in E. coli expression systems, with the following recommended conditions and parameters:

ParameterRecommended Condition
Expression HostE. coli
Vector TagN-terminal His tag
Protein LengthFull Length (1-441 amino acids)
Culture MediumStandard LB or defined media with appropriate antibiotics
InductionIPTG (concentration optimized for specific vector)
Temperature16-20°C for overnight expression (reduces inclusion body formation)
Harvest Time16-20 hours post-induction

For optimal yield, it is recommended to monitor growth via OD600 measurements and determine the best harvest time through small-scale expression tests. The expressed protein can be confirmed through SDS-PAGE and Western blot analysis using anti-His antibodies .

What purification methods are most effective for isolating high-purity R. salina ccs1?

A multi-step purification strategy is recommended for obtaining high-purity R. salina ccs1 protein:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin to capture the His-tagged protein

    • Buffer: Tris/PBS-based buffer, pH 8.0

    • Wash: Low imidazole (10-20 mM) to remove non-specific binding

    • Elution: 250-300 mM imidazole gradient

  • Intermediate Purification: Size exclusion chromatography

    • Buffer: Tris/PBS-based buffer, pH 8.0

    • Column: Superdex 200 or similar

  • Polishing: Ion exchange chromatography if needed for ultra-high purity

  • Buffer Exchange: Final buffer exchange to storage buffer (Tris/PBS-based buffer with 6% trehalose, pH 8.0)

Protein purity should be assessed by SDS-PAGE, with quality greater than 90% recommended for most applications .

How should R. salina ccs1 protein be stored for optimal stability and activity?

Based on available data, the following storage conditions are recommended:

Storage ConditionRecommendation
Short-term (1 week)4°C in storage buffer
Medium-term-20°C with 50% glycerol
Long-term-80°C in aliquots to avoid freeze-thaw cycles
LyophilizationPossible with addition of stabilizers like trehalose

The protein is typically stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0. For reconstitution of lyophilized protein, it should be centrifuged briefly before opening, then reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added as a cryoprotectant .

Repeated freeze-thaw cycles should be avoided as they significantly decrease protein activity and stability .

How can researchers assess the functional activity of recombinant R. salina ccs1?

Functional activity of R. salina ccs1 can be assessed through several complementary approaches:

  • Heme Binding Assay: Based on cytochrome c biogenesis studies, the protein should bind heme with high affinity. This can be measured spectrophotometrically by monitoring absorbance changes at specific wavelengths characteristic of heme binding (around 400-420 nm) .

  • Thioether Bond Formation: Assess the ability of ccs1 to facilitate the formation of thioether bonds between heme and apocytochrome c using in vitro reconstitution assays. This typically involves incubating the protein with heme and an apocytochrome c substrate, followed by analysis of the reaction products .

  • Functional Complementation: Express the protein in a system lacking endogenous cytochrome c biogenesis machinery to determine if it can restore cytochrome c maturation. This approach has been used successfully with other cytochrome c biogenesis systems .

  • Binding Studies with Apocytochromes: Assess protein-protein interactions between R. salina ccs1 and apocytochrome c substrates through techniques such as pull-down assays, surface plasmon resonance, or isothermal titration calorimetry .

What experimental systems are suitable for studying R. salina ccs1 interaction with other cytochrome c biogenesis components?

Several experimental systems can be employed to study the interactions of R. salina ccs1 with other components of the cytochrome c biogenesis machinery:

  • Reconstituted In Vitro Systems: Purified components of the cytochrome c biogenesis machinery can be combined to reconstitute the pathway in vitro. This approach allows for controlled manipulation of reaction conditions and systematic analysis of component interactions .

  • Bacterial Expression Systems: Heterologous expression in E. coli strains lacking their own cytochrome c biogenesis machinery provides a clean background for studying specific components. This approach has been used successfully with System II components .

  • Yeast Two-Hybrid or Bacterial Two-Hybrid Systems: These can be used to screen for protein-protein interactions between R. salina ccs1 and other components of the cytochrome c biogenesis machinery.

  • Pull-Down Assays: His-tagged R. salina ccs1 can be used as bait to capture interacting proteins from cell lysates, followed by mass spectrometry identification.

  • Crosslinking Experiments: Chemical crosslinking followed by mass spectrometry can identify proteins in close proximity to R. salina ccs1 in vivo.

How does the redox state of heme affect its interaction with R. salina ccs1?

Based on research with related cytochrome c biogenesis systems, the redox state of heme significantly impacts its interaction with cytochrome c biogenesis proteins. For CcmE, a related protein in System I:

  • Preferential Binding: There is a significant preference for binding ferric (Fe³⁺) over ferrous (Fe²⁺) heme, with a high affinity binding constant (Kd of approximately 200 nM for ferric heme) .

  • Covalent Attachment: Reduction of the ferric heme-protein complex under specific conditions can lead to covalent attachment of heme to the protein .

  • Heme Transfer: Heme transfer from holo-protein to apocytochrome c appears to require reduced heme. This requirement might explain the role of the heme chaperone in preventing incorrect reactions between ferric heme and apocytochrome .

For R. salina ccs1, similar redox-dependent behavior might be expected, though specific studies would need to be conducted to confirm this. Researchers should consider controlling the redox environment when designing experiments to study R. salina ccs1 function.

How do modifications of the CXXCH motif in apocytochromes affect recognition by R. salina ccs1?

The CXXCH motif in apocytochromes is the canonical site for heme attachment in c-type cytochromes. Studies with related cytochrome c biogenesis systems provide insights into how modifications of this motif affect recognition:

  • Single-Cysteine Variants: AXXCH and CXXAH variants (where one cysteine is replaced with alanine) are not efficiently matured by System II, suggesting both cysteines are critical for recognition and/or catalysis .

  • AXXAH Variants: System II has been shown to mature AXXAH-containing variants into b-type cytochromes, indicating that it can still interact with these variants and facilitate heme delivery, though not covalent attachment .

  • X Residues: The identity of the X residues in the CXXCH motif may also influence recognition, though this is less well characterized.

For R. salina ccs1, similar substrate specificity might be expected, but specific studies would be needed to confirm this. Researchers could employ a series of apocytochrome variants with systematic modifications to the CXXCH motif to systematically characterize the substrate specificity of R. salina ccs1.

How does R. salina ccs1 function within the context of different cytochrome c biogenesis systems?

Cytochrome c biogenesis systems vary across different organisms, with at least five distinct systems identified (Systems I-V). Based on the available information, R. salina ccs1 likely functions within one of these systems, possibly System I or II:

  • System I (Ccm): Found in Gram-negative bacteria, archaea, and plant mitochondria. This complex system involves multiple components (CcmA-I) organized into three functional modules:

    • Heme handling and delivery

    • Apocytochrome preparation

    • Heme-apocytochrome ligation

  • System II: Found in Gram-positive bacteria, cyanobacteria, and chloroplasts. This system comprises four subunits, with ResB and ResC forming the minimal functional unit .

To determine the exact system in which R. salina ccs1 functions, researchers could:

  • Perform comparative sequence analysis with known components of different systems

  • Investigate potential protein-protein interactions with components of different systems

  • Test functional complementation in organisms with defined cytochrome c biogenesis systems

What methodological approaches can differentiate between stereo-specific vinyl-2~Cys1 and vinyl-4~Cys2 thioether bonds in cytochromes matured by R. salina ccs1?

The stereo-specific formation of vinyl-2~Cys1 and vinyl-4~Cys2 thioether bonds is a universal feature of c-type cytochromes. To investigate whether R. salina ccs1 maintains this stereo-specificity, several methodological approaches can be employed:

  • Mass Spectrometry: High-resolution mass spectrometry combined with specific proteolytic digestion can identify the precise attachment points of heme to the apocytochrome protein.

  • NMR Spectroscopy: Nuclear magnetic resonance can provide detailed structural information about the thioether bonds.

  • X-ray Crystallography: Crystal structures of matured cytochromes can reveal the stereo-specific arrangement of the thioether bonds.

  • Biochemical Approaches: Using modified hemes with alterations to specific vinyl groups can test the necessity of each vinyl group for thioether bond formation. For instance, mesoheme (where vinyl groups are replaced with ethyl groups) has been used to demonstrate the requirement of vinyl groups for covalent binding .

  • Site-Directed Mutagenesis: Systematic modification of the apocytochrome CXXCH motif, followed by analysis of the resulting heme attachment, can provide insights into the specificity of the thioether bond formation.

What are the common challenges in expressing and purifying active R. salina ccs1, and how can they be addressed?

Based on information about similar recombinant proteins, researchers may encounter several challenges when working with R. salina ccs1:

ChallengeSolution Approaches
Protein Insolubility- Lower expression temperature (16-20°C)
- Use solubility-enhancing fusion tags (SUMO, MBP)
- Optimize buffer conditions (detergents for membrane proteins)
- Consider expressing only the soluble domains
Low Expression Yield- Optimize codon usage for expression host
- Test different E. coli strains (BL21(DE3), Rosetta, etc.)
- Adjust induction conditions (IPTG concentration, induction time)
- Use auto-induction media
Protein Degradation- Include protease inhibitors during purification
- Use E. coli strains lacking specific proteases
- Optimize purification speed to minimize degradation time
Loss of Activity- Ensure proper redox conditions are maintained
- Include stabilizing agents (glycerol, trehalose)
- Avoid repeated freeze-thaw cycles
- Prepare fresh protein for critical experiments
Aggregation- Include low concentrations of stabilizing agents
- Optimize buffer composition and pH
- Consider size exclusion chromatography as a final step

How can researchers optimize in vitro functional assays for R. salina ccs1 to ensure reproducible results?

To ensure reproducible results in functional assays for R. salina ccs1, researchers should consider:

  • Quality Control of Components:

    • Ensure high purity (>90%) of the recombinant protein

    • Characterize the protein thoroughly (SDS-PAGE, mass spectrometry)

    • Use freshly prepared or properly stored protein to avoid degradation

  • Redox Control:

    • Maintain defined redox conditions during assays, given the importance of redox state in cytochrome c biogenesis

    • Consider including reducing agents like DTT or MESA (2-mercaptoethane sulfonate)

    • Monitor and control oxygen levels in reaction mixtures

  • Reaction Conditions:

    • Optimize buffer composition, pH, temperature, and ionic strength

    • Include appropriate cofactors and metal ions

    • Control reaction time to capture kinetic parameters

  • Analytical Methods:

    • Develop sensitive and specific assays for detecting heme binding and transfer

    • Employ multiple orthogonal techniques to confirm results

    • Include appropriate positive and negative controls

  • Substrate Preparation:

    • Ensure consistent preparation of apocytochrome substrates

    • Verify the absence of pre-bound heme in apocytochromes

    • Consider using multiple substrate variants to assess specificity

What emerging technologies could enhance our understanding of R. salina ccs1 structure-function relationships?

Several cutting-edge technologies could significantly advance our understanding of R. salina ccs1:

  • Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized structural biology by allowing visualization of proteins in their native state without crystallization. It could provide insights into the structure of R. salina ccs1 alone or in complex with other components of the cytochrome c biogenesis machinery.

  • AlphaFold and Other AI-Based Structure Prediction: These computational tools have demonstrated remarkable accuracy in predicting protein structures. They could provide structural models of R. salina ccs1 to guide experimental design.

  • Single-Molecule Techniques: Methods such as single-molecule FRET could track the dynamics of interactions between R. salina ccs1, heme, and apocytochromes in real-time.

  • Native Mass Spectrometry: This approach could characterize protein-protein and protein-heme interactions under near-native conditions.

  • Time-Resolved X-ray Crystallography: This technique could capture intermediates in the cytochrome c biogenesis process, providing insights into the mechanism.

  • Nanobody-Assisted Structural Biology: Nanobodies could stabilize specific conformations of R. salina ccs1 for structural studies.

What are the implications of R. salina ccs1 research for understanding evolutionary diversity in cytochrome c biogenesis systems?

Research on R. salina ccs1 has significant implications for understanding the evolutionary diversity of cytochrome c biogenesis systems:

  • Evolutionary Conservation and Divergence: Comparing R. salina ccs1 with homologs from other organisms could reveal conserved functional domains and species-specific adaptations.

  • System Plasticity: Studies on substrate specificity, like those showing System II can mature cytochromes normally processed by System I , suggest a level of plasticity in these systems that may have facilitated evolutionary transitions.

  • Organelle Evolution: As R. salina is a cryptophyte alga, studying its cytochrome c biogenesis system could provide insights into the evolution of plastids and mitochondria, particularly in the context of endosymbiotic events .

  • Functional Convergence: The existence of multiple distinct systems for cytochrome c biogenesis suggests convergent evolution, where different molecular solutions evolved to perform the same biochemical function. Understanding R. salina ccs1 could provide insights into this phenomenon.

  • Ancient Metabolic Pathways: Cytochrome c-dependent respiratory and photosynthetic electron transport chains are ancient metabolic pathways. Studying the diversity in their biogenesis systems could provide insights into early cellular evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.