Recombinant Rhodomonas salina Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is assigned during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Rhodomonas salina (Cryptomonas salina)
Target Names
ycf4
Target Protein Sequence
MQTRYDLILGSRRFSNYLWTLISFSGGIGFLLAGLSSYLGVQLLPFGNTETIVFIPQGIV MTFYGTIGILLSLFLLLNISLNVGGGYNSYDKSTGAIQIFRLGFPGKRRKILLQYKIQEI KSIKLSIAEGLNPKREIYLQTKDQRQIPLTRVGEPLLLSQIEEEAVELANFLNIPLEGL
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Ycf4 and how is it organized in thylakoid membranes?

Ycf4 is a 22-kD thylakoid membrane protein containing two putative transmembrane domains that anchor it within the membrane . This protein is encoded by the chloroplast genome in eukaryotes and displays remarkable conservation among photosynthetic organisms from cyanobacteria to higher plants . Electron microscopy studies have revealed that Ycf4 forms part of a large complex with dimensions measuring approximately 285 × 185 Å, suggesting several potential oligomeric states . When isolated through tandem affinity purification techniques, the Ycf4-containing complex demonstrates a molecular mass exceeding 1500 kD, indicating extensive protein-protein interactions . This complex architecture likely facilitates its scaffolding role during PSI assembly by providing multiple binding sites for interaction with newly synthesized PSI polypeptides .

What is the primary function of Ycf4 in the context of photosystem assembly?

Ycf4 serves as an essential auxiliary factor for photosystem I assembly, particularly critical in Chlamydomonas reinhardtii where its absence prevents PSI accumulation . Biochemical studies utilizing pulse-chase protein labeling have demonstrated that the Ycf4 complex associates with newly synthesized PSI polypeptides, specifically the reaction center subunits PsaA and PsaB, along with peripheral subunits including PsaC, PsaD, PsaE, and PsaF . This association occurs during the early stages of PSI biogenesis, with the Ycf4 complex appearing to function as a molecular scaffold that facilitates the proper spatial arrangement of PSI components during their assembly . The complex stabilizes these newly synthesized subunits as they form a pigment-containing subcomplex, representing an intermediate assembly state before the formation of the complete PSI complex . Intriguingly, while Ycf4 is absolutely essential for PSI assembly in C. reinhardtii, cyanobacterial mutants lacking Ycf4 can still assemble PSI, albeit at reduced levels, suggesting some evolutionary divergence in assembly mechanisms .

How does Ycf4 interact with other photosystem I assembly factors?

Ycf4 functions within a sophisticated network of assembly factors that collectively orchestrate PSI biogenesis through sequential, coordinated interactions . Research has revealed that Ycf4 operates alongside three other key auxiliary factors: Ycf3, Y3IP1/CGL59, and Ycf37/PYG7/CGL71 . These factors appear to work in a stepwise manner, with Ycf3 assisting the initial assembly of newly synthesized PsaA/B subunits into a reaction center subcomplex . Y3IP1 likely functions as an intermediary, transferring this RC subcomplex from Ycf3 to the Ycf4 module that provides stabilization . The Ycf4 complex also shows intimate and exclusive association with COP2, an opsin-related protein that influences complex stability under varying salt conditions, although COP2 itself is not essential for PSI assembly . Through affinity purification studies, researchers have observed that almost all Ycf4 and COP2 in wild-type cells copurify by sucrose gradient ultracentrifugation and ion exchange chromatography, underscoring their close physical relationship .

What techniques are most effective for recombinant expression and purification of Ycf4?

Tandem affinity purification (TAP) tagging represents the gold standard methodology for isolating Ycf4 and its associated complex with high purity and yield . This approach involves fusing a TAP-tag consisting of calmodulin binding peptide and Protein A domains, separated by a tobacco etch virus (TEV) protease cleavage site, to the C-terminus of Ycf4 . Expression constructs can be introduced into Chlamydomonas reinhardtii or other model organisms through chloroplast transformation using plasmids containing the modified gene and a selectable marker such as spectinomycin resistance (aadA) . Following expression, Ycf4 complexes can be isolated through a two-step affinity chromatography procedure: first binding to IgG agarose through the Protein A domain, then cleavage with TEV protease, followed by capture on calmodulin resin and elution with EGTA . For optimal results, thylakoid membranes should be solubilized with n-dodecyl-β-D-maltoside (DDM) prior to purification, and overnight incubation with IgG agarose in a rotating column at 4°C maximizes binding efficiency . This methodology has successfully yielded Ycf4 complexes that retain their native interaction partners and structural integrity as confirmed by electron microscopy .

How can researchers assess the functional activity of recombinant Ycf4?

Functional assessment of recombinant Ycf4 requires a multi-faceted approach combining biochemical, spectroscopic, and genetic complementation techniques . Researchers should first evaluate whether the recombinant protein forms the characteristic large complex (>1500 kD) by performing sucrose gradient ultracentrifugation and monitoring the distribution pattern of Ycf4 across gradient fractions . Immunoblotting analysis using anti-Ycf4 antibodies can confirm proper expression and stability of the recombinant protein . To determine if the recombinant Ycf4 retains its ability to participate in PSI assembly, researchers should measure PSI accumulation through spectroscopic techniques that quantify P700 content and activity . Fluorescence induction kinetics of dark-adapted cells offer another reliable method to verify PSI function in vivo . The gold standard for functional validation involves genetic complementation experiments in Ycf4-deficient mutants, measuring parameters such as photoautotrophic growth under different light intensities (e.g., medium light at 50 μE·m^-2·s^-1 or high light at 1000 μE·m^-2·s^-1) to confirm restoration of photosynthetic capacity .

What analytical methods best characterize Ycf4-PSI assembly intermediates?

Characterization of Ycf4-PSI assembly intermediates requires sophisticated analytical techniques to capture these transient complexes . Pulse-chase protein labeling with radioactive amino acids represents a powerful approach for tracking newly synthesized PSI polypeptides as they associate with the Ycf4 complex . Mass spectrometry (specifically liquid chromatography-tandem mass spectrometry) provides definitive identification of proteins within the complex, capable of detecting both the major components and less abundant interaction partners . Electron microscopy combined with single particle analysis offers structural insights, revealing the dimensions and architectural features of the Ycf4-containing complex . For studying the dynamics of assembly, researchers should employ blue native gel electrophoresis to separate assembly intermediates based on size while maintaining native protein interactions . Sucrose gradient ultracentrifugation followed by immunoblotting analysis of gradient fractions can resolve different assembly states and their protein composition . For temporal analysis of the assembly process, synchronized cultures combined with time-course sampling enables researchers to track the sequential formation of intermediates during PSI biogenesis .

How do mutations in specific Ycf4 domains affect PSI assembly efficiency?

Mutational analysis of Ycf4 domains reveals critical structure-function relationships that influence PSI assembly pathways . While detailed mutational studies of Ycf4 are still emerging, research on related assembly factors provides insight into potential approaches and outcomes . Transmembrane domains of Ycf4 likely anchor the protein in the thylakoid membrane, positioning it optimally for interaction with nascent PSI polypeptides . Mutations in these domains would potentially alter membrane integration and subsequently disrupt complex formation with COP2 and PSI subunits . The extramembrane portions of Ycf4 presumably contain binding sites for specific PSI subunits, and targeted mutations in these regions might selectively impair interactions with particular components without completely abolishing function . Of particular interest for future research are the specific amino acid residues that mediate the interaction between Ycf4 and COP2, as RNA interference experiments reducing COP2 to 10% of wild-type levels increased salt sensitivity of the Ycf4 complex stability without affecting PSI accumulation . This suggests that the Ycf4-COP2 interaction may primarily enhance complex stability rather than being directly involved in the assembly process .

What is the interplay between Ycf4 and the other auxiliary factors in PSI assembly?

The assembly of PSI involves a coordinated sequence of interactions among four key auxiliary factors: Ycf3, Y3IP1/CGL59, Ycf4, and Ycf37/PYG7/CGL71 . Each of these factors plays a distinct role in the stepwise assembly process . Ycf3, containing tetratrico-peptide repeats, initiates the process by assisting the assembly of newly synthesized PsaA/B subunits into a reaction center subcomplex, with direct interactions between Ycf3 and PsaA previously documented . Y3IP1 appears to function as a transfer factor, facilitating the movement of the nascent RC subcomplex from Ycf3 to the Ycf4 module . The Ycf4 complex then stabilizes this subcomplex, potentially through scaffolding interactions that maintain proper spatial relationships among the assembling components . CGL71 (the homolog of Ycf37) may form an oligomeric structure that transiently interacts with the PSI RC subcomplex, physically protecting it under oxic conditions until it can associate with peripheral PSI subunits . This sequential handoff mechanism ensures the proper assembly of the complex photosystem structure and represents a sophisticated quality control system during biogenesis .

What are common challenges in expressing recombinant Ycf4 and how can they be addressed?

Expression of recombinant Ycf4 presents several technical challenges that researchers must navigate carefully . The membrane-integrated nature of Ycf4 with its two transmembrane domains complicates heterologous expression systems, potentially leading to protein aggregation or improper membrane insertion . For chloroplast expression systems like those in Chlamydomonas reinhardtii, researchers should ensure homoplasmy (complete replacement of wild-type chloroplast DNA copies with the tagged version) through multiple rounds of selection on spectinomycin-containing media and PCR verification . When adding tags for purification or detection, C-terminal fusion is preferable as demonstrated with the TAP-tag system, which successfully maintained Ycf4 functionality . Researchers should verify that tagged versions retain wild-type activity through complementation tests, measuring parameters such as photoautotrophic growth and PSI accumulation . For optimal solubilization prior to purification, n-dodecyl-β-D-maltoside (DDM) has proven effective at maintaining the integrity of the large Ycf4-containing complex . When purifying via affinity chromatography, the adsorption efficiency of TAP-tagged Ycf4 to IgG agarose may be suboptimal, necessitating overnight incubation in a rotating column at 4°C to maximize binding .

What considerations are important when comparing Ycf4 function between different photosynthetic model organisms?

Cross-species comparative analysis of Ycf4 function requires careful consideration of several factors that influence experimental outcomes and interpretations . Researchers must account for differences in genetic manipulation techniques—chloroplast transformation is well-established in Chlamydomonas but more challenging in many other algae and plants . The genetic background of each model organism significantly impacts experimental results, with potential compensatory mechanisms or redundant factors varying across species . Environmental growth conditions should be standardized as much as possible when making direct comparisons, as light intensity, temperature, and nutrient availability can all affect PSI assembly pathways . The evolutionary distance between species being compared must be considered when interpreting functional differences, as Ycf4 from cyanobacteria appears less essential for PSI assembly than its counterpart in Chlamydomonas reinhardtii . When expressing Ycf4 from one species in another (heterologous expression), researchers should verify proper protein localization to the thylakoid membrane and formation of the characteristic large complex . Finally, researchers should assess both qualitative phenotypes (such as the ability to grow photoautotrophically) and quantitative measures (like PSI/PSII ratios or specific activity of PSI) to gain comprehensive insight into functional conservation and divergence across photosynthetic lineages .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.