Recombinant Rhodopirellula baltica ATP-dependent zinc metalloprotease FtsH 2 (ftsH2)

Shipped with Ice Packs
In Stock

Description

Introduction

FtsH proteases are a family of ATP-dependent zinc metalloproteases found in bacteria, mitochondria, and chloroplasts . These proteases play essential roles in protein quality control by degrading misfolded or damaged proteins and regulating protein stability . In organisms with multiple FtsH homologs, such as cyanobacteria, the selective pairing of FtsH isoforms leads to the formation of distinct homo- and heterocomplexes, each with specialized functions . One such protease is the Recombinant Rhodopirellula baltica ATP-dependent zinc metalloprotease FtsH 2 (FtsH2), derived from the bacterium Rhodopirellula baltica .

Mechanism of Action

FtsH complexes perform ATP-dependent proteolysis by unfolding and translocating target substrates through the central pore of the ATPase complex to the protease domain for degradation . A flexible linker of approximately 20 amino acids, located between the transmembrane and ATPase domains, allows substrates to access the protease . A phenylalanine residue near the central pore of the ATPase domain is responsible for substrate binding .

Function

FtsH proteases play a crucial role in protein quality control . They degrade short-lived proteins, enabling cellular regulation at the level of protein stability, and eliminate misassembled membrane proteins . In chloroplasts, FtsH is involved in repairing photosystem II (PSII) damage caused by photoinhibition through the cleavage of the PSII reaction center protein D1 subunit .

FtsH2 in Rhodopirellula baltica

Rhodopirellula baltica FtsH2 is an ATP-dependent zinc metalloprotease with the accession number Q7URM7 . The protein is 728 amino acids long and contains an N-terminal transmembrane domain, an AAA-ATPase domain, and a zinc metalloprotease domain .

Research Findings

Research AreaFindings
PSII BiogenesisFtsH proteases are involved in the degradation of the damaged D1 subunit of Photosystem II (PSII) during its biogenesis.
Protein Complex FormationFtsH proteases form hetero-complexes with proteins involved in photosynthetic processes.
Protein Quality ControlFtsH proteases degrade misfolded and damaged proteins in the thylakoid membrane, ensuring protein homeostasis.
Substrate RecognitionFtsH contains a phenylalanine residue on the top surface near the central pore of the ATPase domain, responsible for substrate binding.
Structural StudiesFtsH forms a hexameric structure with a double-ring arrangement.
Role in BBB TranscytosisMetalloproteases, such as Mpr1, can engage AnnexinA2 to promote fungal cell transcytosis across the blood-brain barrier (BBB).
Energy-Utilizing EndopeptidaseFtsH is an energy-utilizing and processive endopeptidase, capable of dislocating membrane protein substrates for degradation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
ftsH2; RB5566; ATP-dependent zinc metalloprotease FtsH 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-728
Protein Length
full length protein
Species
Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Target Names
ftsH2
Target Protein Sequence
MSNEPKSKRGGSSENRGGGNVWLVLLAVTGAVVLSAFLFSDNRRRLAYPHLKELLAMSAE RQEMLEAQRSASESGDAAANVDGESRPESSVISRSSSALISGDPANDIPVPKIVVPSSTK EDVWHEFSRLDNIFVADDRITGKVHFKSFVKNHPSEKEPAEEVTFLTIRGYPNDLIAAEL EDLLVQSGVKWDNDRPSRFLENHWPELLMIGVLVALGIVMLKRMGGVGSPMSFSRSRGKL YSEDDLPTTFEDVAGIEEAVDEVREVVDFLKNSEKYQSLGGRIPKGVLLVGPPGTGKTLL AKAIAGEAGVPFFSLSGSDFVEMFVGVGAARVRDMFTQAVNRAPCIIFIDELDALGKSRS GSVVGGHDEREQTLNALLVEMDGFDSNSGVIVVAATNRPETLDPALLRPGRFDRHVLVDR PDVAGREEILAVHVKNVKLDETVELKGIASITSGFVGADLANLVNEAALLAARNGKPAVA MEEFNEAVERVTAGLEKKNRVMNEDEKIRVAYHESGHALVAAALPNTDPVHKVSIIPRGL AALGYMMQRPESERFLMTKSELESQMKVMLAGTLAEEMIFQDISTGAQNDLERCTETARS MVMDYGMSRLGRINLRRNTRSPFLAGSGGGEYQIMHSDEMAKMIDKEVSRIVDDMLVHTR EILEQRRDVLEAVTQRLLEVEAIDSDELMRLIQENSRGPWLVPGTVTEKPKAKIVPREET ESQQSNRS
Uniprot No.

Target Background

Function

This recombinant Rhodopirellula baltica ATP-dependent zinc metalloprotease FtsH2 functions as a processive, ATP-dependent zinc metallopeptidase, targeting both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.

Database Links

KEGG: rba:RB5566

STRING: 243090.RB5566

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is Rhodopirellula baltica and why is it an important model organism?

Rhodopirellula baltica is a marine bacterium belonging to the globally distributed phylum Planctomycetes, which exhibits unique cell morphology and intriguing lifestyle characteristics. This organism has gained significance as a model system due to its biotechnologically promising features, including distinctive sulfatases and C1-metabolism genes identified during genome analysis. R. baltica displays salt resistance and adhesion capabilities in the adult phase of its cell cycle, making it valuable for studying bacterial adaptation mechanisms in marine environments .

The organism undergoes substantial transcriptional changes throughout its growth phases, with up to 12% of its genes showing differential regulation between exponential and stationary phases. These changes reflect adaptation to varying nutrient availability and environmental conditions. Researchers value R. baltica as a model system for understanding complex bacterial life cycles and cellular differentiation processes that have potential biotechnological applications .

What are the basic characteristics of ATP-dependent zinc metalloproteases like FtsH2?

ATP-dependent zinc metalloproteases of the FtsH family are membrane-bound enzymes that play crucial roles in protein quality control within cells. These proteases typically form hexameric ring structures and contain two functional domains: an ATPase domain belonging to the AAA+ (ATPases Associated with diverse cellular Activities) superfamily, and a proteolytic domain featuring a zinc-binding motif. The FtsH2 subtype is particularly important in chloroplasts of photosynthetic organisms, where it participates in the regulated turnover of photosystem components .

FtsH proteases use ATP hydrolysis to drive conformational changes that enable protein substrate unfolding and translocation into the proteolytic chamber. The zinc ion in the metalloprotease domain coordinates the water molecule needed for peptide bond hydrolysis. These enzymes demonstrate remarkable substrate specificity and are often regulated through complex mechanisms, including subunit composition variations, post-translational modifications, and interactions with regulatory proteins .

How does recombinant expression of Rhodopirellula baltica FtsH2 differ from its native expression?

Recombinant expression of R. baltica FtsH2 involves several technical considerations that distinguish it from native expression. In its natural environment, R. baltica produces FtsH2 in response to specific physiological conditions and growth phases, with expression levels precisely regulated according to cellular needs. During recombinant production, researchers typically use controlled expression systems with inducible promoters to achieve higher protein yields than would naturally occur .

One significant difference is that native FtsH2 integrates into membrane complexes with proper folding assisted by chaperones specific to R. baltica, whereas recombinant expression may require optimization of conditions to ensure correct folding and assembly. Native expression is influenced by factors such as nutrient availability, growth phase, and environmental stress, as demonstrated by transcriptional profiling studies of R. baltica cultures. Research has shown that R. baltica cells increase expression of stress-related proteins and modify cell wall composition during the transition to stationary phase, which may impact native FtsH2 function and regulation .

What is the oligomeric structure of FtsH2 complexes and how does it impact function?

FtsH2 proteases typically form hexameric complexes that function as molecular machines for protein degradation. Structural modeling studies of FtsH complexes reveal that these hexamers can exist as either homohexamers (composed of identical subunits) or heterohexamers (composed of different FtsH subunit types). Detailed in silico analysis of FtsH2 from photosynthetic organisms indicates that heterohexameric complexes containing both type A (like FtsH5) and type B (like FtsH2) subunits are thermodynamically favored over homohexameric structures .

The buried surface area calculations from molecular modeling reveal that substituting specific FtsH2 subunits with FtsH5 subunits can significantly increase the stability of the complex. For instance, when chains c and e of an FtsH2 homohexamer were substituted with FtsH5 chains, the buried surface area increased by 1006 Ų, indicating a more stable structure. This enhanced stability likely translates to improved function, as the proper arrangement of subunits ensures optimal coordination of ATP hydrolysis with substrate translocation and proteolysis. The specific positioning of different subunit types within the hexameric ring may also create unique interaction surfaces that determine substrate specificity and regulatory protein binding .

How do post-translational modifications regulate FtsH2 activity?

Post-translational modifications play crucial roles in regulating FtsH2 activity, with phosphorylation being particularly important. Studies of chloroplastic FtsH complexes have demonstrated that the phosphorylation status of FtsH subunits can significantly impact their assembly, substrate specificity, and catalytic activity. Phosphorylation can alter the surface charge distribution of FtsH2 subunits, potentially affecting their interactions with other subunits and regulatory partners .

The regulation of FtsH2 through phosphorylation appears to be responsive to environmental conditions and cellular stress. In photosynthetic organisms, changes in light intensity or oxidative stress can trigger signaling cascades that alter the phosphorylation levels of FtsH complexes. This modification mechanism provides a rapid means of adjusting protease activity without requiring changes in gene expression, allowing for prompt responses to environmental challenges. Specific phosphorylation sites have been identified that may serve as molecular switches, enabling fine-tuning of FtsH2 function according to cellular needs .

What is the role of FtsH2 in stress response and cell adaptation?

During stationary phase, R. baltica induces numerous stress-related proteins, including glutathione peroxidase (RB2244), thioredoxin (RB12160), universal stress protein (uspE, RB4742), and various chaperones. These changes coincide with metabolic adaptations for long-term survival under unfavorable conditions. The organism also modifies its cell wall composition and increases production of extracellular polysaccharides, forming characteristic rosette structures. FtsH2, as a membrane-bound protease, likely contributes to these adaptation processes by selectively removing damaged membrane proteins and regulating the turnover of key stress response components .

What are the optimal methods for recombinant expression and purification of active R. baltica FtsH2?

The optimal expression of recombinant R. baltica FtsH2 typically requires a carefully designed experimental approach. Based on research with similar metalloproteases, an E. coli expression system using BL21(DE3) or Rosetta strains with a pET vector containing an N-terminal His-tag often provides good results. Expression should be induced at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) to promote proper folding of this complex membrane-associated protein. Addition of zinc to the growth medium may improve the incorporation of the metal cofactor into the active site .

Purification of active FtsH2 requires a multi-step approach, beginning with membrane fraction isolation using ultracentrifugation, followed by solubilization with mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin that maintain the native oligomeric structure. Immobilized metal affinity chromatography (IMAC) using the His-tag, followed by size exclusion chromatography to separate properly assembled hexamers from monomers or aggregates, typically yields the best results. Enzymatic activity should be verified using appropriate substrates and ATP hydrolysis assays to confirm that the purified protein maintains its dual ATPase and protease functions. Throughout purification, it is essential to maintain conditions that preserve the oligomeric structure, as this is critical for FtsH2 function .

How can researchers effectively analyze the oligomeric state of FtsH2 complexes?

Analyzing the oligomeric state of FtsH2 complexes requires a combination of complementary techniques to achieve reliable results. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides accurate determination of molecular mass independent of shape, allowing verification of hexameric assembly. Blue native polyacrylamide gel electrophoresis (BN-PAGE) offers a relatively accessible approach for analyzing native protein complexes and can be paired with western blotting to confirm subunit composition .

Advanced structural techniques provide more detailed insights into FtsH2 oligomerization. Negative-stain electron microscopy offers initial visualization of hexameric structures, while cryo-electron microscopy can achieve near-atomic resolution of the complete complex. For highest resolution details, X-ray crystallography remains valuable, though crystallization of membrane protein complexes presents significant challenges. For in vivo studies, researchers have successfully employed epitope tagging approaches, such as C-terminal HA-tags, which allow monitoring of complex formation in the native cellular environment without disrupting function. In silico modeling provides another powerful approach, as demonstrated in studies comparing buried surface areas between different FtsH subunit arrangements to predict the most thermodynamically favorable configurations .

What are the key considerations when designing assays to measure FtsH2 proteolytic activity?

Designing robust assays for FtsH2 proteolytic activity requires careful consideration of multiple factors. First, appropriate substrate selection is crucial—while generic fluorogenic peptides can provide basic activity measurements, using physiologically relevant protein substrates offers more meaningful insights into specificity and regulation. When using natural substrates, they should be properly folded and, if membrane-associated, incorporated into suitable membrane mimetics such as nanodiscs or liposomes .

The assay buffer composition significantly impacts activity measurements. Key considerations include pH optimization (typically 7.5-8.0), metal ion concentrations (particularly zinc as the catalytic cofactor), salt concentration affecting substrate binding, and appropriate detergent types and concentrations to maintain FtsH2 solubility without disrupting its structure or function. ATP concentration must be optimized and regenerating systems may be included for extended assays. Temperature control is essential as FtsH2 from the marine bacterium R. baltica may have different thermal optima than homologs from other species. Finally, developing appropriate controls is vital—these should include measurements with ATP analogs that permit binding but not hydrolysis to distinguish between ATP-dependent conformational changes and actual proteolysis, as well as assays with site-directed mutants affecting either ATPase or protease domains to confirm specificity .

How does the subunit composition of FtsH2-containing heterohexamers affect substrate specificity?

The subunit composition of FtsH2-containing heterohexamers significantly influences substrate specificity through multiple mechanisms. Structural modeling studies of FtsH complexes demonstrate that different arrangements of type A and type B subunits create unique substrate-binding interfaces within the hexameric ring. For example, when specific positions within an FtsH2 homohexamer (chains c and e) were substituted with FtsH5 subunits, the resulting complex showed not only increased structural stability but also altered surface properties that likely impact substrate recognition .

What is the relationship between ATPase activity and proteolytic function in R. baltica FtsH2?

The relationship between ATPase activity and proteolytic function in R. baltica FtsH2 represents a sophisticated example of mechanochemical coupling in enzyme catalysis. ATP hydrolysis drives conformational changes in the AAA+ domains that are transmitted to the protease domains, facilitating substrate unfolding, translocation through the central pore, and ultimately degradation. This coupling ensures that energy expenditure is tightly linked to productive proteolysis, preventing futile ATP consumption .

Research with FtsH proteases has revealed that the coupling between these activities follows a sequential mechanism where ATP binding induces hexamer assembly and substrate engagement, while ATP hydrolysis drives substrate translocation in discrete steps. The hexameric arrangement creates an interconnected network where nucleotide state changes in one subunit affect the conformation and activity of neighboring subunits. This coordinated action enables the complex to generate sufficient mechanical force to unfold stable protein substrates. Mutations affecting the coordination between ATPase and protease domains can result in uncoupled activities, where ATP continues to be hydrolyzed without productive proteolysis, highlighting the importance of proper communication between functional domains. Understanding this relationship in R. baltica FtsH2 has implications for both basic science and potential biotechnological applications .

How does the expression of FtsH2 change during the life cycle of R. baltica, and what are the functional implications?

During early exponential phase (44h), R. baltica shows elevated expression of genes associated with rapid growth and division, including those involved in DNA replication, energy production, and amino acid metabolism. As cultures progress to mid-exponential (62h) and late-exponential phases (82h), metabolic adaptations occur in response to decreasing nutrient availability. The transition to stationary phase (96h-240h) triggers significant upregulation of stress response genes, including those encoding glutathione peroxidase, thioredoxin, universal stress protein (uspE), and various chaperones. R. baltica also modifies its cell wall composition and increases production of extracellular polysaccharides during this phase, as evidenced by enhanced formation of characteristic rosette structures. These changes suggest that proteases like FtsH2 likely play important roles in protein turnover and membrane remodeling during adaptation to nutrient limitation and preparation for long-term survival under unfavorable conditions .

Growth Phase ComparisonNumber of Regulated GenesPercentage of GenomeHypothetical Proteins
62h vs. 44h1492%84 (56%)
82h vs. 62h901%40 (44%)
96h vs. 82h2353%139 (59%)
240h vs. 82h86312%499 (58%)

What structural features determine the thermodynamic preference for heterohexameric over homohexameric FtsH2 complexes?

The thermodynamic preference for heterohexameric over homohexameric FtsH2 complexes stems from specific structural features at the subunit interfaces. Detailed in silico modeling of FtsH complexes has revealed that strategic substitution of FtsH2 subunits with complementary FtsH5 subunits significantly increases the buried surface area at subunit interfaces, indicating enhanced stability. For example, when chains c and e in an FtsH2 homohexamer were replaced with FtsH5 chains, the total buried surface area increased by 1006 Ų compared to the homohexameric structure .

How do FtsH2 proteases from R. baltica compare structurally and functionally with those from photosynthetic organisms?

The most significant functional difference lies in their physiological roles and regulatory networks. In photosynthetic organisms, FtsH2 (classified as type B) forms heterohexameric complexes with type A subunits like FtsH5, playing crucial roles in photosystem II repair and thylakoid membrane protein quality control. These complexes respond to light-induced damage and oxidative stress. In contrast, R. baltica FtsH2 functions within the context of a marine bacterium's life cycle, with expression patterns suggesting roles in adaptation to nutrient limitation during transition to stationary phase. Transcriptional profiling of R. baltica cultures has revealed complex regulation of stress response genes during growth phase transitions, with numerous hypothetical proteins showing differential expression that may interact with FtsH2 or its substrates. The substrate specificity and regulatory mechanisms have likely evolved to match the distinct physiological challenges faced by each organism .

What insights from studies on plant FtsH complexes can be applied to understanding R. baltica FtsH2?

Studies on plant FtsH complexes provide valuable insights that can enhance our understanding of R. baltica FtsH2, particularly regarding oligomeric assembly and regulation. Research on Arabidopsis FtsH complexes has demonstrated that heterohexameric structures composed of type A and type B subunits are thermodynamically favored over homohexameric assemblies. This principle likely extends to bacterial FtsH systems, suggesting that R. baltica may also form mixed FtsH complexes with specific subunit arrangements that optimize stability and function .

The phosphorylation-based regulation observed in plant FtsH complexes represents another potentially transferable concept. Studies have shown that phosphorylation states of FtsH subunits can modulate their activity and substrate specificity. Similar post-translational modifications might regulate R. baltica FtsH2, especially during transitions between growth phases when significant physiological adaptations occur. The epitope-tagging approaches used successfully with plant FtsH2 could be adapted for R. baltica studies, allowing in vivo tracking of complex formation and dynamics. Furthermore, the in silico modeling methodologies used to analyze buried surface areas and predict optimal subunit arrangements in plant FtsH complexes provide a valuable template for investigating R. baltica FtsH assemblies, potentially guiding experimental designs to characterize these complexes in their native context .

How can the Google "People Also Ask" feature be optimized for scientific content about R. baltica FtsH2?

Optimizing scientific content about R. baltica FtsH2 for Google's "People Also Ask" feature requires a strategic approach to content structure and presentation. Contrary to popular belief, FAQ schema markup is not strictly necessary for inclusion in these features. Instead, research indicates that directly addressing specific questions in a clear, authoritative manner is more effective. Scientific content should be structured with the question as both the title tag and H1 heading, followed immediately by a direct answer to that question before expanding into deeper explanations .

For scientific content about R. baltica FtsH2, researchers should identify common questions in their field and structure separate content sections addressing each one. For example, questions about "How does R. baltica FtsH2 differ from plant FtsH2?" or "What techniques are most effective for purifying active R. baltica FtsH2?" should be explicitly stated as headers followed by concise, authoritative answers. Unlike general web content, scientific material should maintain its depth and rigor while front-loading the direct answer to each question. The content should avoid unnecessary introductory material before providing the answer, as this approach has been shown to reduce the likelihood of selection for featured snippets. Including relevant data tables, structural information, and methodological details enhances the content's authority, but the primary answer to each question should be clearly identifiable without requiring readers to parse through technical details first .

What are the most promising applications of recombinant R. baltica FtsH2 in biotechnology and basic research?

Recombinant R. baltica FtsH2 offers several promising applications in both biotechnology and basic research fields. As an ATP-dependent metalloprotease with specific substrate recognition capabilities, it has potential applications in protein engineering for the selective degradation of target proteins in biotechnological processes. The enzyme's adaptation to marine environments suggests it may possess unique salt tolerance and activity properties that could be valuable for industrial applications requiring robust proteases that function under challenging conditions .

In basic research, recombinant R. baltica FtsH2 provides an excellent model system for studying the molecular mechanisms of ATP-dependent proteolysis and protein quality control. The ability to produce and manipulate this protein enables detailed structure-function analyses that can reveal fundamental principles of protease regulation applicable across diverse biological systems. Additionally, comparative studies between R. baltica FtsH2 and homologs from other organisms can provide evolutionary insights into how these essential enzymes have adapted to different cellular environments and physiological demands. R. baltica's unique life cycle and cell biology, combined with its biotechnologically promising features, make its FtsH2 protease a valuable target for both applied and theoretical research endeavors .

What unresolved questions about R. baltica FtsH2 warrant further investigation?

Several crucial questions about R. baltica FtsH2 remain unresolved and warrant dedicated investigation. The complete substrate profile of FtsH2 in R. baltica has not been comprehensively characterized, leaving significant gaps in our understanding of its physiological roles. While transcriptional profiling has revealed expression patterns during different growth phases, the specific protein targets regulated by FtsH2 during these transitions remain largely unknown. Identifying these substrates would provide valuable insights into the protease's function in cellular adaptation to changing environmental conditions .

The potential formation of heterohexameric complexes involving FtsH2 in R. baltica represents another unresolved question. While studies in plants have demonstrated that heterohexameric FtsH complexes are thermodynamically favored over homohexameric structures, whether similar principles apply in R. baltica remains unknown. Additionally, the regulatory mechanisms controlling FtsH2 activity in R. baltica, particularly potential post-translational modifications like phosphorylation, require investigation. The specific cellular factors that interact with FtsH2 to modulate its activity or localization also remain to be identified. Understanding these aspects would significantly enhance our knowledge of protein quality control systems in this unique marine bacterium and potentially reveal novel regulatory mechanisms applicable to other biological systems .

How might advances in computational modeling and structural biology enhance our understanding of R. baltica FtsH2?

Advances in computational modeling and structural biology offer transformative potential for understanding R. baltica FtsH2. Modern molecular dynamics simulations can now model large protein complexes over extended timescales, potentially revealing the conformational changes that couple ATP hydrolysis to substrate translocation and proteolysis in FtsH2 hexamers. These simulations could identify critical residues at the interface between ATPase and protease domains that transmit mechanical force, providing targets for experimental validation and functional engineering .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.