Recombinant Rhodopirellula baltica Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant LspA is typically purified in Tris-based buffer with 50% glycerol, optimized for stability. Storage recommendations include:

  • Short-term: 4°C (up to 1 week)

  • Long-term: -20°C or -80°C (avoid repeated freeze-thaw cycles) .

Functional Insights

LspA processes preprolipoproteins by cleaving N-terminal signal peptides after diacylglyceryl modification by Lgt. In R. baltica, this enzyme is hypothesized to support:

  • Lipoprotein maturation: Essential for membrane localization of virulence factors and transporters.

  • Stress adaptation: Transcriptional regulation under environmental stress, as observed in related bacteria .

While R. baltica’s genome encodes >100 sulfatases and niche metabolic pathways , LspA’s role in its physiology remains underexplored compared to model organisms like Escherichia coli or Staphylococcus aureus .

Applications and Research Utility

Recombinant R. baltica LspA is primarily used for:

  1. Enzymatic studies: Investigating substrate specificity and inhibitor resistance (e.g., globomycin) .

  2. Comparative genomics: Analyzing evolutionary conservation of lipoprotein processing in Planctomycetes .

  3. Antibiotic development: Validating LspA as a target for novel antibacterial agents .

Limitations and Future Directions

Current knowledge gaps include:

  • In vivo activity: Limited data on LspA’s role in R. baltica’s life cycle or host interactions .

  • Structural details: No resolved crystal structure for R. baltica LspA, unlike its counterparts in E. coli or S. aureus .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
lspA; RB10374; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Target Names
lspA
Target Protein Sequence
MNSAKVNPSGHAPTPAPTASQGAAFPANRYALFFGLAIAGGALDLWSKEAIFRWRGLPGT QDVYWIIEGYFGIETAVNIGAVFGLGAGQGLVFAAISVFAAAAIIAWLFFFKAARSCWLT FALGCITGGIIGNLYDRLGFWWKPGLPDQWQSGVRDWILWQASDQWKWPNFNIADSLLVT GAIMLLVQSFFFPPPPHGEADGNELPGRRAPDEPTEGTKPAAS
Uniprot No.

Target Background

Function
Recombinant Rhodopirellula baltica Lipoprotein signal peptidase (lspA) specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: rba:RB10374

STRING: 243090.RB10374

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Lipoprotein Signal Peptidase in Rhodopirellula baltica?

Lipoprotein signal peptidase (LspA) in Rhodopirellula baltica functions as an aspartyl protease that cleaves the transmembrane helix signal peptide of lipoproteins during post-translational processing. This enzyme plays a critical role in the lipoprotein-processing pathway essential for proper cell function in this marine bacterium. R. baltica belongs to the phylum Planctomycetes, whose members exhibit unique cellular compartmentalization and peptidoglycan-free proteinaceous cell walls . The organism undergoes a complex life cycle with distinct morphological phases similar to Caulobacter crescentus, involving motile and sessile states . LspA activity is likely essential during these morphological transitions, particularly as R. baltica adapts its cell wall composition in response to environmental conditions. During the stationary phase, R. baltica modifies its membrane composition by upregulating diverse genes for outer membrane transporters, biopolymers, and transferases involved in lipopolysaccharide modification . The significance of LspA lies in its role in processing lipoproteins that may be critical for these adaptive responses.

What expression systems are most effective for recombinant production of R. baltica LspA?

For expression of R. baltica LspA, an E. coli-based expression system using the pET28b vector with an N-terminal 6xHis tag has proven effective for homologous LspA proteins . This approach facilitates purification via affinity chromatography and allows for subsequent tag removal via thrombin cleavage. When adapting this protocol for R. baltica LspA, researchers should consider the following methodology:

  • Vector design: Incorporate the R. baltica LspA gene into pET28b with an N-terminal 6xHis tag and thrombin cleavage site

  • Host selection: BL21(DE3) E. coli strains are recommended for membrane protein expression

  • Induction parameters: Use low IPTG concentrations (0.1-0.5 mM) and lower temperatures (16-20°C) to promote proper folding

  • Membrane fraction isolation: Employ ultracentrifugation following cell disruption

  • Detergent screening: Test multiple detergents for optimal solubilization (DDM, LDAO, etc.)

R. baltica's distinct biology may necessitate codon optimization of the LspA gene for E. coli expression, considering its marine origin and potentially different codon usage patterns. Additionally, R. baltica's growth patterns, including its transition through different morphological phases , suggest that expression conditions may need to be carefully optimized to obtain functionally active recombinant LspA.

How do conformational dynamics affect R. baltica LspA function and substrate specificity?

The functional significance of LspA conformational dynamics likely extends to R. baltica LspA, with important implications for substrate recognition and catalytic activity. In homologous LspA proteins, the periplasmic helix fluctuates on the nanosecond timescale between multiple conformational states . These dynamics create an equilibrium between:

  • A closed conformation (dominant in the apo state) that shields the charged active site residues from the hydrophobic membrane environment

  • An open conformation that allows substrate access to the catalytic site

  • Intermediate conformations stabilized by antibiotic or substrate binding

This conformational flexibility explains how LspA accommodates diverse lipoprotein substrates with varying signal peptide sequences. For R. baltica LspA specifically, these dynamics may be particularly important given the organism's complex life cycle and changing membrane composition throughout different growth phases . During the transition from exponential to stationary phase, R. baltica undergoes significant transcriptional changes affecting membrane proteins and secreted proteins , suggesting that LspA must process various lipoprotein substrates under different cellular conditions.

To investigate these dynamics in R. baltica LspA, a hybrid approach combining molecular dynamics (MD) simulations with electron paramagnetic resonance (EPR) spectroscopy would be most effective, as demonstrated for other LspA proteins . Site-directed spin labeling of cysteine residues introduced at strategic positions can provide experimental restraints to validate computational models of conformational states.

What methodological approaches are optimal for assessing inhibitor binding to R. baltica LspA?

Investigating inhibitor binding to R. baltica LspA requires a multi-faceted approach combining structural, biophysical, and functional assays. Based on studies with homologous LspA proteins, the following methodology is recommended:

Structural methods:

  • X-ray crystallography: Co-crystallization with inhibitors such as globomycin, as demonstrated for P. aeruginosa LspA

  • Cryo-EM: For inhibitor complexes resistant to crystallization

  • Site-directed spin labeling with EPR: To monitor conformational changes upon inhibitor binding

Biophysical assays:

  • Thermal shift assays: To quantify stabilization upon inhibitor binding

  • Microscale thermophoresis: For binding affinity determination

  • Isothermal titration calorimetry: To determine thermodynamic parameters of binding

Functional analysis:

  • In vitro enzymatic assays: Using synthetic fluorogenic peptide substrates

  • Cellular growth inhibition: In expression systems dependent on LspA function

The periplasmic helix of LspA adopts different conformations with different inhibitors bound, as shown in comparative studies of globomycin and myxovirescin binding . For R. baltica LspA, researchers should particularly focus on how the unique features of this marine bacterium's membrane environment might influence inhibitor interactions. The extensive conservation of active site residues across bacterial species suggests that inhibitors effective against other LspA proteins may also inhibit R. baltica LspA .

How does salt concentration affect the stability and activity of recombinant R. baltica LspA?

Given R. baltica's marine origin, salt concentration represents a critical parameter affecting recombinant LspA stability and function. R. baltica exhibits salt resistance as one of its notable physiological features, making it potentially valuable for biotechnological applications . This adaptation suggests that its proteins, including LspA, may have evolved unique structural adaptations for function in higher salt environments.

Experimental approach for salt dependence analysis:

Salt Concentration (mM NaCl)Enzymatic Activity (%)Thermal Stability (Tm, °C)Secondary Structure (CD Signal)
0BaselineBaselineBaseline
50MeasureMeasureMeasure
150MeasureMeasureMeasure
300MeasureMeasureMeasure
500MeasureMeasureMeasure
750MeasureMeasureMeasure

Researchers should investigate how salt concentration affects:

  • Protein stability: Using differential scanning fluorimetry and circular dichroism

  • Membrane integration: Through reconstitution studies in liposomes of varying ionic strength

  • Catalytic activity: Using synthetic peptide substrates corresponding to R. baltica lipoprotein signal sequences

  • Conformational dynamics: By measuring EPR spectra of spin-labeled variants at different salt concentrations

The adaptation of R. baltica to marine environments likely influences the ionic interactions within its LspA structure, potentially requiring specific salt conditions for optimal folding and function of the recombinant protein.

What are the critical factors for successful purification of active R. baltica LspA?

Purification of active recombinant R. baltica LspA presents several challenges due to its membrane-embedded nature. Based on protocols for homologous proteins, a systematic purification strategy should include:

  • Detergent selection: Screen a panel of detergents including DDM, LDAO, and digitonin for optimal extraction while maintaining activity

  • Two-step affinity purification:

    • Initial IMAC purification using the His-tag

    • Second affinity step using a substrate analog column

  • Size exclusion chromatography: To ensure monodispersity and remove aggregates

  • Activity verification: Using fluorogenic peptide substrates to confirm functional state

Critical factors to consider during purification:

Purification StageCritical ParameterOptimization Strategy
Membrane extractionDetergent type/concentrationSystematic screening of 8-10 detergents
Affinity chromatographyImidazole concentrationShallow gradients to prevent premature elution
Buffer compositionSalt concentrationTest range from 150-500 mM based on R. baltica's marine origin
Protein stabilityTemperatureMaintain samples at 4°C throughout purification
Final preparationStorage conditionsTest glycerol (10-20%) and reducing agents for long-term stability

R. baltica's unique biology, including its adaptation to marine environments and specialized cell membrane composition , may necessitate modifications to standard membrane protein purification protocols. The incorporation of stabilizing agents that mimic the native marine environment may be particularly important for maintaining LspA activity throughout purification.

How can researchers design activity assays specific to R. baltica LspA?

Designing specific activity assays for R. baltica LspA requires consideration of its natural substrates and catalytic mechanism. Based on general LspA function as an aspartyl protease cleaving lipoprotein signal peptides , the following methodological approaches are recommended:

Synthetic substrate design:

  • Analyze the R. baltica genome to identify putative lipoprotein signal sequences

  • Design fluorogenic peptides containing these sequences with FRET pairs flanking the cleavage site

  • Verify cleavage site specificity through mass spectrometry of reaction products

Assay optimization parameters:

  • pH range: 5.5-8.0 (test in 0.5 unit increments)

  • Temperature: 20-40°C (R. baltica's optimal growth is 28°C )

  • Salt concentration: 0-500 mM (reflecting marine adaptation)

  • Detergent environment: Screen detergents compatible with activity

Controls and validation:

  • Catalytic dead mutants (mutations in the aspartate dyad)

  • Inhibition by known LspA inhibitors (globomycin, myxovirescin)

  • Comparison with LspA from other bacterial species

R. baltica's distinct cell wall lacking peptidoglycan suggests its lipoproteins may have unique features compared to those in other bacteria. Therefore, substrate design should account for potential differences in signal peptide recognition sequences. Additionally, the assay conditions should reflect the organism's life cycle phases, as gene expression patterns change significantly throughout growth , potentially affecting substrate specificity.

What strategies can overcome expression challenges for R. baltica LspA in heterologous systems?

Expressing functional R. baltica LspA in heterologous systems presents several challenges due to its membrane protein nature and the unique biology of Planctomycetes. To overcome these challenges, researchers should consider the following strategies:

  • Codon optimization: Adapt the R. baltica LspA gene for optimal expression in the host organism

  • Fusion partners:

    • N-terminal partners: MBP, SUMO, or Mistic to improve folding

    • C-terminal GFP to monitor expression and folding

  • Expression conditions optimization:

    • Reduced temperature (16-20°C)

    • Extended induction periods (16-24 hours)

    • Low inducer concentrations

Troubleshooting expression issues:

ChallengePossible CauseSolution Strategy
Low expression levelsToxicity to hostUse tight promoter control, C41/C43 E. coli strains
Inclusion body formationImproper foldingLower temperature, co-express chaperones
Proteolytic degradationHost proteasesInclude protease inhibitors, use protease-deficient strains
Poor membrane integrationIncompatible secretionOptimize signal sequences for the host system
Inactive proteinImproper disulfide formationInclude oxidizing agents, co-express disulfide isomerases

R. baltica's unique cellular features, including peptidoglycan-free cell walls and intracellular compartmentalization , suggest its proteins may have evolved distinctive characteristics that could complicate heterologous expression. The genome contains many genes encoding hypothetical proteins active throughout its life cycle , indicating that uncharacterized accessory proteins might be required for proper LspA folding or function in the native host.

How can conformational dynamics of R. baltica LspA inform antibiotic development?

The conformational dynamics of LspA provide valuable insights for structure-based drug design targeting this essential bacterial enzyme. For R. baltica LspA, the following methodological approach can leverage dynamics information for antibiotic development:

  • Identify targetable conformational states:

    • The closed conformation (dominant in apo state) occludes the active site from the lipid bilayer

    • The open conformation allows substrate access

    • Intermediate states may present unique binding pockets

  • Structure-activity relationship (SAR) studies:

    • Design compounds that stabilize specific conformational states to prevent catalytic activity

    • Focus on the highly conserved active site residues (14 conserved residues surrounding the catalytic dyad)

    • Target the dynamic periplasmic helix that regulates substrate access

  • Resistance barrier assessment:

    • The extensive conservation of the active site suggests a high barrier to resistance mutations

    • Mutations affecting antibiotic binding would likely also impair substrate binding and catalysis

The nanosecond timescale fluctuations of the periplasmic helix observed in homologous LspA proteins likely occur in R. baltica LspA as well, creating transient binding pockets that could be exploited for drug design. The hybrid approach of molecular dynamics simulations validated by EPR spectroscopy provides a powerful methodology for characterizing these states in R. baltica LspA .

What comparative insights can be gained from studying LspA across different bacterial phyla?

Comparative analysis of LspA from R. baltica (Planctomycetes) with homologs from other bacterial phyla (e.g., Proteobacteria, Firmicutes) offers valuable evolutionary and functional insights. This approach should:

  • Compare sequence conservation patterns:

    • Core catalytic residues (universally conserved)

    • Substrate-binding regions (more variable, reflecting substrate diversity)

    • Membrane-interacting domains (adapted to different bacterial membranes)

  • Analyze structural adaptations:

    • Periplasmic helix conformational preferences across species

    • β-cradle architecture variations

    • Active site accessibility differences

  • Correlate with ecological niches:

    • How marine adaptation in R. baltica affects LspA properties

    • Compare with LspA from other extreme environments

R. baltica's unique features, including its marine habitat, peptidoglycan-free cell wall, and complex life cycle with morphological transitions , likely influenced the evolution of its LspA. The organism's ability to shift from motile swarmer cells to sessile cells with holdfast substances throughout its life cycle suggests its LspA may process different sets of lipoproteins during these transitions.

Comparative genomic analysis reveals that R. baltica has many unique genes not found in other bacteria, including numerous hypothetical proteins and specialized enzymes such as sulfatases . This genetic distinctiveness may extend to modifications in the lipoprotein processing pathway, potentially resulting in unique features of R. baltica LspA compared to homologs from well-studied Gram-negative and Gram-positive bacteria.

How does LspA activity vary throughout R. baltica's complex life cycle?

The complex life cycle of R. baltica, involving transitions between motile and sessile forms similar to Caulobacter crescentus , suggests temporal regulation of LspA activity to process stage-specific lipoproteins. To investigate this relationship, researchers should:

  • Correlate LspA expression with life cycle stages:

    • Early exponential phase (dominated by swarmer and budding cells)

    • Mid-exponential phase (transition state)

    • Stationary phase (dominated by rosette formations)

  • Identify life cycle-specific lipoprotein substrates:

    • Analyze transcriptomic data for lipoprotein expression patterns

    • Correlate with R. baltica's microarray data showing differential gene regulation

  • Examine post-translational regulation:

    • Investigate potential allosteric regulators of LspA activity

    • Assess membrane composition changes that might affect LspA function

The extensive transcriptional remodeling observed throughout R. baltica's growth phases suggests that different sets of lipoproteins are expressed and require processing by LspA at different stages. For example, in the stationary phase, R. baltica alters its cell wall composition and exports more polysaccharides as shown by enhanced formation of rosettes . These changes likely involve numerous lipoproteins that must be processed by LspA.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.