Recombinant Rhodopirellula baltica UPF0365 protein RB6291 (RB6291)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhodopirellula baltica UPF0365 Protein RB6291

The Recombinant Rhodopirellula baltica UPF0365 protein RB6291 is a recombinant protein derived from the marine bacterium Rhodopirellula baltica. This protein is of particular interest due to its unique characteristics and potential applications in biotechnology and microbiological research. Rhodopirellula baltica is a member of the Planctomycetes phylum, known for its distinctive cell compartmentalization and lack of peptidoglycan in its cell walls .

Characteristics of Recombinant Rhodopirellula baltica UPF0365 Protein RB6291

  • Protein Structure and Expression: The recombinant protein RB6291 is expressed in Escherichia coli and is fused with an N-terminal His tag, facilitating its purification and identification . It consists of 345 amino acids, making it a full-length protein.

  • Purity and Storage: The protein is available in a lyophilized powder form with a purity of greater than 90% as determined by SDS-PAGE. It is recommended to store it at -20°C or -80°C and to avoid repeated freeze-thaw cycles .

  • Amino Acid Sequence: The amino acid sequence of RB6291 includes a variety of motifs and domains that could be involved in different cellular functions, although specific roles are not well-documented .

Research Findings and Applications

  • Protein Function: While the specific function of the UPF0365 protein RB6291 is not well-documented, proteins from Rhodopirellula baltica often have unique roles due to the bacterium's distinctive cellular structure and metabolic pathways . The protein is sometimes referred to as a hypothetical protein or a flotillin-like protein, suggesting potential involvement in membrane organization or signaling .

  • Biotechnological Potential: The recombinant expression of proteins like RB6291 in E. coli highlights the potential for biotechnological applications, such as studying protein function, developing novel enzymes, or understanding bacterial cell biology .

References Creative Biomart. Recombinant Full Length Rhodopirellula baltica UPF0365 protein RB6291(RB6291) Protein (Q7UQJ2) (1-345aa), fused to N-terminal His tag, was expressed in E. coli. Voß, B., et al. (2005). Growth phase dependent regulation of protein composition in Rhodopirellula baltica. Proteomics, 5(11), 2843–2855. Gade, D., et al. Proteomic analysis of carbohydrate catabolism and regulation in the marine bacterium Rhodopirellula baltica. Wang, Y., et al. (2021). Multi-omics Study of Planobispora rosea, Producer of the Thiopeptide Antibiotic GE2270A. Frontiers in Microbiology, 12, 1–15. MyBioSource. Recombinant Rhodopirellula baltica UPF0365 protein RB6291 (RB6291). Jenkins, C., et al. Evaluation of the phylogenetic position of the planctomycetes. Fuchs, B. M., et al. (2004). Novel protein domains and motifs in the marine planctomycete Rhodopirellula baltica. Proteomics, 4(7), 2071–2080.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA1; RB6291; Flotillin-like protein FloA 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Target Names
RB6291
Target Protein Sequence
MAMIDLTHDWQLLAQNPAGGLNSSSLLLLVGVFLALFFAAVLGFFFLRYGKLWFQAFMSD ADVQLLNLIRMHFTKVNPNVIVQAKVMVAQAGLNIGRRDGISTHRLEAHYLAGGNVMNVI HAIIAAHRAQIPLEFDQAAAIDLAGRDVLDAVQTSVYPKVIDCPDPKRSGKTTLSAITKN GVELRVRTRVTVRTNIEQLIGGATEDTVIARVGEAIISSIGSAETHFKVLENPDMITRVV LSRGLDAQTAFEIVSIDIADIDVGENIGARLQNDQAEADTRVARAQAERRRAEAIAAEQQ MNARVSENRSRLVLAEADVPRALAEAFKAGRIGNVSSVAAAEGSA
Uniprot No.

Target Background

Function

Recombinant Rhodopirellula baltica UPF0365 protein RB6291 (RB6291) is found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. These FMMs are highly dynamic and increase in number with cellular aging. Flotillins are believed to play a significant role in maintaining membrane fluidity.

Database Links

KEGG: rba:RB6291

STRING: 243090.RB6291

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Single-pass membrane protein. Membrane raft; Single-pass membrane protein.

Q&A

What are the recommended storage and handling conditions for RB6291 protein preparations?

For optimal stability and activity preservation of RB6291 protein preparations, researchers should follow these evidence-based protocols:

  • Storage temperature: Store at -20°C for regular use, or at -80°C for extended storage periods

  • Buffer composition: The protein is stable in Tris-based buffer with 50% glycerol, which has been optimized specifically for this protein

  • Freeze-thaw cycles: Repeated freezing and thawing should be strictly avoided as it can lead to protein denaturation and activity loss

  • Working aliquots: When actively using the protein, store working aliquots at 4°C for a maximum of one week to minimize freeze-thaw damage

When designing experiments, researchers should consider validating protein stability under their specific experimental conditions through activity assays or structural integrity tests (e.g., circular dichroism) before proceeding with complex studies.

What experimental considerations should be taken into account when using RB6291 in ELISA-based detection systems?

When incorporating RB6291 in ELISA-based detection systems, researchers should address several methodological considerations:

  • Antibody selection: Since RB6291 is available as a recombinant protein, consider whether the detection antibodies recognize native epitopes or tag-dependent epitopes. The tag type for commercial RB6291 is determined during the production process and may vary between preparations

  • Blocking optimization: Design controlled experiments comparing different blocking agents (BSA, milk proteins, commercial blockers) to determine optimal signal-to-noise ratios specific to RB6291

  • Temperature conditions: Given RB6291's storage requirements, conduct comparative ELISA runs at different incubation temperatures (4°C, room temperature, 37°C) to determine optimal antigen-antibody interaction conditions

  • Validation controls: Include both positive controls (purified RB6291 at known concentrations) and negative controls (related proteins from the UPF0365 family) to establish specificity parameters

These methodological considerations align with general experimental design principles in immunoassay development, where control of variables is essential for reliable results2.

What approaches are most effective for studying protein-protein interactions involving RB6291?

For investigating protein-protein interactions involving RB6291, researchers should employ a multi-method approach tailored to membrane-associated proteins:

  • Pull-down assays and co-immunoprecipitation:

    • Optimize detergent conditions that maintain RB6291's native conformation (given its potential membrane association)

    • Consider crosslinking approaches to stabilize transient interactions

    • Use recombinant RB6291 as both bait (immobilized) and prey (in solution) to validate bidirectional interactions

  • Surface Plasmon Resonance (SPR):

    • Immobilize RB6291 using the buffer conditions specified (Tris-based buffer with 50% glycerol)

    • Design concentration gradients of potential interacting proteins

    • Analyze association/dissociation kinetics to distinguish specific from non-specific interactions

  • Proximity-based methods:

    • For cellular studies, consider FRET/BRET approaches with RB6291 fused to appropriate fluorophores

    • For in vitro studies, hydrogen-deuterium exchange mass spectrometry can map interaction interfaces

  • Computational prediction:

    • Use the full amino acid sequence provided for in silico interaction prediction

    • Validate computational predictions with at least two orthogonal experimental approaches

When interpreting data, researchers should consider the experimental design principles of appropriate controls and variable isolation to establish causality in observed interactions2.

How can researchers address challenges in structural characterization of RB6291?

Structural characterization of RB6291 presents several challenges, particularly due to its potential membrane association. A methodologically rigorous approach includes:

Each approach should include appropriate experimental controls to distinguish methodological artifacts from true structural features, aligning with fundamental principles of experimental design2.

What methods are recommended for functional characterization of RB6291?

For comprehensive functional characterization of RB6291, researchers should implement a systematic experimental design that addresses both in vitro and cellular contexts:

  • Sequence-based functional prediction:

    • Conduct detailed sequence analysis of RB6291's 345 amino acids against characterized domains

    • Identify conserved motifs that might suggest enzymatic or binding functions

    • Generate testable hypotheses based on these predictions

  • In vitro biochemical assays:

    • Design activity screens based on predicted functions (e.g., binding assays, enzymatic activity tests)

    • Develop quantitative assays with appropriate positive and negative controls

    • Test activity under varying conditions (pH, temperature, ionic strength) to establish optimal parameters

  • Cellular studies:

    • Generate knockout/knockdown models in relevant cell systems

    • Complement with rescue experiments using recombinant RB6291

    • Analyze resulting phenotypes through transcriptomics, proteomics, or metabolomics approaches

  • Interactome mapping:

    • Identify potential binding partners through affinity purification-mass spectrometry

    • Validate key interactions through orthogonal methods

    • Place RB6291 within functional networks based on interaction data

These approaches embody the experimental design principle of testing hypotheses through multiple independent methods, increasing confidence in functional assignments2.

What are the most effective ways to study post-translational modifications of RB6291?

Post-translational modifications (PTMs) of RB6291 require specialized methodological approaches to detect, characterize, and determine their functional significance:

  • Mass spectrometry-based PTM mapping:

    • Employ multiple proteolytic digestion strategies to ensure complete sequence coverage of RB6291

    • Use enrichment techniques specific to predicted modifications (phosphorylation, glycosylation, etc.)

    • Implement both data-dependent and targeted MS approaches for comprehensive PTM detection

  • Site-directed mutagenesis for functional validation:

    • Generate RB6291 variants with modified potential PTM sites (e.g., Ser/Thr to Ala for phosphorylation)

    • Compare wildtype and mutant proteins in functional assays to determine PTM significance

    • Consider phosphomimetic mutations (e.g., Ser/Thr to Asp/Glu) for mechanistic studies

  • PTM-specific detection methods:

    • Develop or source PTM-specific antibodies for immunological detection

    • Use protein staining methods specific for certain PTMs (e.g., Pro-Q Diamond for phosphorylation)

    • Employ chemical labeling strategies for specific PTM types

  • Temporal dynamics studies:

    • Investigate PTM patterns under different conditions or time points

    • Correlate PTM changes with functional alterations

    • Map regulatory pathways affecting RB6291 PTMs

These methodological approaches align with experimental design principles of controlling variables and establishing causality between PTMs and protein function2.

How should researchers design experiments to investigate RB6291 stability under different buffer conditions?

A methodologically sound experimental design for investigating RB6291 stability across buffer conditions should include:

  • Buffer matrix design:

    • Test multiple buffer systems (Tris, phosphate, HEPES) at varied pH ranges (5.5-9.0)

    • Evaluate ionic strength effects (50-500 mM salt concentration)

    • Assess stabilizing additives (glycerol concentrations from 10-50%)

    • Include detergent screening if membrane association is confirmed

  • Stability assessment methods:

    • Thermal shift assays to determine melting temperatures under each condition

    • Activity assays to correlate structural stability with functional integrity

    • Size-exclusion chromatography to monitor aggregation propensity

    • Dynamic light scattering for solution homogeneity analysis

  • Long-term stability monitoring:

    • Store protein in selected conditions at different temperatures (-80°C, -20°C, 4°C)

    • Assess activity/structural parameters at defined time points (day 0, 7, 14, 30, 90)

    • Compare freeze-thaw stability across buffer conditions

  • Statistical analysis plan:

    • Design experiments with appropriate replication (minimum n=3)

    • Implement two-way ANOVA to assess interaction between buffer components and temperature

    • Use post-hoc tests to identify optimal stability conditions

This approach embodies experimental design principles of systematically testing variables while maintaining appropriate controls2.

What considerations should researchers address when designing expression systems for recombinant RB6291 production?

When designing expression systems for recombinant RB6291 production, researchers should implement a methodologically rigorous approach:

  • Host system selection rationale:

    • Evaluate prokaryotic systems (E. coli) for basic expression

    • Consider eukaryotic systems (yeast, insect cells) if post-translational modifications are critical

    • Assess cell-free systems for rapid prototyping of expression constructs

  • Construct design strategy:

    • Optimize codon usage for selected expression host

    • Design multiple constructs with varying purification tags (N-terminal, C-terminal, cleavable)

    • Consider solubility-enhancing fusion partners if membrane association causes expression challenges

  • Expression condition optimization:

    • Implement factorial design to test induction parameters (temperature, inducer concentration, time)

    • Evaluate growth media formulations to maximize yield while maintaining proper folding

    • Develop scalable protocols from small-scale screening to preparative-scale production

  • Purification strategy development:

    • Design multi-step purification schemes with orthogonal separation principles

    • Validate final product purity through multiple analytical techniques (SDS-PAGE, Western blot, mass spectrometry)

    • Confirm activity/structure of purified protein compared to native RB6291

This methodological framework allows researchers to systematically identify optimal conditions for recombinant RB6291 production while maintaining experimental rigor2.

How can researchers effectively analyze contradictory results in RB6291 functional studies?

When faced with contradictory results in RB6291 functional studies, researchers should implement this methodological framework:

  • Systematic variable analysis:

    • Create a comprehensive table comparing experimental conditions across contradictory studies

    • Identify critical differences in protein preparation (expression system, tags, purification method)

    • Evaluate buffer compositions, including the standard Tris-based buffer with 50% glycerol used for RB6291

    • Assess experimental timelines and temperature conditions

  • Methodological validation:

    • Reproduce key experiments with standardized protein preparations

    • Implement orthogonal methods to test the same functional hypothesis

    • Evaluate sensitivity and specificity of assays used in contradictory studies

  • Statistical reanalysis:

    • Calculate effect sizes and confidence intervals for contradictory results

    • Perform power analysis to determine if sample sizes were sufficient

    • Consider meta-analytical approaches if multiple datasets are available

  • Reconciliation strategies:

    • Develop testable hypotheses that could explain apparent contradictions

    • Design critical experiments specifically addressing these hypotheses

    • Consider context-dependent functions as a potential explanation

This approach exemplifies sound experimental design principles by systematically investigating variables that might explain contradictory results, rather than simply rejecting one set of findings2.

What statistical approaches are most appropriate for analyzing RB6291 binding affinity data?

For rigorous analysis of RB6291 binding affinity data, researchers should implement these statistical methodologies:

  • Model selection and fitting:

    • Compare one-site versus multi-site binding models using information criteria (AIC, BIC)

    • Evaluate cooperative versus non-cooperative binding models if appropriate

    • Use global fitting approaches when analyzing multiple datasets simultaneously

  • Parameter estimation:

    • Calculate binding constants (KD) with appropriate confidence intervals

    • Determine association and dissociation rate constants (kon, koff) from kinetic data

    • Derive thermodynamic parameters (ΔG, ΔH, ΔS) from temperature-dependent studies

  • Validation approaches:

    • Implement bootstrapping or jackknife resampling to assess parameter robustness

    • Perform residual analysis to evaluate goodness of fit

    • Conduct sensitivity analysis to identify influential data points

  • Comparative analysis:

    • Use appropriate statistical tests (paired t-tests, ANOVA) when comparing binding under different conditions

    • Apply multiple comparison corrections when testing numerous conditions

    • Incorporate hierarchical models when analyzing related binding partners

These statistical approaches align with experimental design principles by providing quantitative frameworks for hypothesis testing and parameter estimation in binding studies2.

What quality control metrics should be established for recombinant RB6291 preparations?

A comprehensive quality control framework for recombinant RB6291 preparations should include:

  • Purity assessment metrics:

    • SDS-PAGE with densitometry analysis (target: >95% purity)

    • High-performance liquid chromatography (HPLC) profile analysis

    • Mass spectrometry confirmation of intact mass and sequence coverage

  • Structural integrity validation:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Thermal shift assay to establish consistent melting temperature

    • Dynamic light scattering to verify monodispersity and absence of aggregation

  • Functional verification:

    • Activity assays relevant to predicted function

    • Binding assays if interaction partners are known

    • Comparative analysis against reference standard

  • Storage stability parameters:

    • Accelerated stability testing at elevated temperatures

    • Freeze-thaw cycle resistance evaluation

    • Long-term storage testing at recommended conditions (-20°C or -80°C)

These quality control metrics should be documented in a standardized format with defined acceptance criteria, ensuring batch-to-batch consistency and experimental reproducibility.

How can researchers troubleshoot issues with RB6291 solubility and aggregation?

When encountering solubility or aggregation issues with RB6291, researchers should implement this methodological troubleshooting framework:

  • Systematic buffer optimization:

    • Screen pH ranges (5.5-9.0) with 0.5 unit increments

    • Test multiple buffer systems (Tris, phosphate, HEPES, MES)

    • Evaluate ionic strength effects (50-500 mM NaCl)

    • Assess stabilizing additives (glycerol, sucrose, arginine)

    • Consider specialized additives for membrane proteins if relevant

  • Physical parameter adjustment:

    • Optimize protein concentration to identify aggregation thresholds

    • Test temperature effects on solubility (4°C, room temperature)

    • Evaluate freeze-thaw protocols and their impact on aggregation

  • Analytical characterization:

    • Implement dynamic light scattering to quantify aggregation state

    • Use size-exclusion chromatography to separate and quantify different oligomeric forms

    • Apply analytical ultracentrifugation for detailed solution behavior analysis

  • Sequence-based intervention:

    • Identify aggregation-prone regions using computational prediction

    • Design constructs excluding problematic regions

    • Consider point mutations to improve solubility without compromising function

These troubleshooting approaches reflect experimental design principles by systematically varying conditions to isolate critical factors affecting RB6291 solubility and aggregation 2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.