Recombinant Rhodopirellula baltica UPF0365 protein RB6389 (RB6389)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA2; RB6389; Flotillin-like protein FloA 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Target Names
RB6389
Target Protein Sequence
MRRPMIASLLLDTLPLAQMPKVTTALLIGALVIFAGIVVVLFIFTSYFGLWIQSVLTGSK ISFGNLIGMTFRKVNTRAIVRSKIMATQAGLDDPELTVGALEAHYLAGGNVQQVIRALIA AKKAKTISLTFREATAIDLAGRDVLESVQTSVYPKVIDCPPRGSAKPSLDAVAKDGIQLK VRARVTVRANLQQLIGGATEETIIARVGEGIVSAIGSADDHKAVLENPDVISKAVLVKKL DSQTAFEIVSIDIADIDVGANIGARLQADQAEADTAVARANAEGRRAAAVAEEQEMQAEI AKSQAQVVEAQSDVPRAMAEAFRSGKLLVMDYYRLQNVSADTEMRRALAGHSHDPDTPEE TH
Uniprot No.

Target Background

Function

Recombinant Rhodopirellula baltica UPF0365 protein RB6389 (RB6389) is found within functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. These FMMs are highly dynamic structures, increasing in number with cellular aging. Flotillins are believed to play a significant role in regulating membrane fluidity.

Database Links

KEGG: rba:RB6389

STRING: 243090.RB6389

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Single-pass membrane protein. Membrane raft; Single-pass membrane protein.

Q&A

What is UPF0365 protein RB6389 from Rhodopirellula baltica?

UPF0365 protein RB6389 is a 362-amino acid protein encoded by the RB6389 gene in Rhodopirellula baltica, a marine bacterium belonging to the phylum Planctomycetes. According to commercial sources, it is also known as floA2 or flotillin-like protein FloA 2 . Rhodopirellula baltica exhibits unique characteristics including peptidoglycan-free proteinaceous cell walls, intracellular compartmentalization, and reproduction via budding . As a member of the UPF0365 protein family, RB6389's specific function remains incompletely characterized, though its flotillin-like designation suggests potential roles in membrane organization and cellular processes.

What are the optimal storage conditions for recombinant RB6389 protein?

For optimal stability and functionality, recombinant RB6389 protein should be stored according to these parameters:

Storage ParameterRecommendation
Short-term storage4°C for up to one week (working aliquots)
Long-term storage-20°C to -80°C, with -80°C preferred for extended periods
Buffer compositionTris-based buffer with 50% glycerol, pH 8.0
Special considerationsAliquot before freezing to avoid repeated freeze-thaw cycles
Reconstitution (if lyophilized)Deionized sterile water to 0.1-1.0 mg/mL

All commercial sources emphasize that repeated freezing and thawing is not recommended as it significantly compromises protein integrity .

What expression systems are most effective for producing recombinant RB6389?

Based on available commercial products, E. coli is the predominant expression system for recombinant RB6389 production . The full-length protein (residues 1-362) is typically expressed with an N-terminal His-tag to facilitate downstream purification. For researchers developing their own expression systems, several considerations should be addressed:

  • Codon optimization for the host organism

  • Temperature modulation (typically lower temperatures of 15-25°C reduce inclusion body formation)

  • Induction parameters (inducer concentration and timing)

  • Cell density at induction

  • Harvest timing

The membrane-associated nature of RB6389 (containing hydrophobic regions) may require additional optimization to enhance solubility and proper folding during expression .

How can researchers rapidly assess expression of recombinant RB6389 in different conditions?

A rapid dot-blot methodology offers significant time advantages over traditional Western blotting for expression screening, as described in research protocols . This approach involves:

  • Collecting small culture samples under different expression conditions

  • Rapid cell lysis using detergent-based buffers

  • Direct spotting of lysates onto nitrocellulose membrane

  • Incubation with HRP-conjugated antibody against the protein tag (e.g., anti-His antibody)

  • Chemiluminescent detection

This technique enables researchers to screen multiple expression conditions (temperature, inducer concentration, time points) in under one hour, allowing rapid optimization of expression parameters before scaling up production .

What purification strategies are most effective for His-tagged RB6389?

While the search results do not provide explicit purification protocols specific to RB6389, effective strategies for His-tagged recombinant proteins typically include:

  • Initial capture using immobilized metal affinity chromatography (IMAC)

  • Consideration of detergent inclusion for membrane-associated proteins

  • Buffer optimization to maintain protein solubility

  • Additional polishing steps using size exclusion or ion exchange chromatography if higher purity is required

For membrane-associated proteins like RB6389, special consideration should be given to detergent selection during extraction and purification to maintain native protein conformation while ensuring effective separation from host cell proteins.

What structural features characterize UPF0365 protein RB6389?

Analysis of the amino acid sequence reveals several notable structural features:

  • Hydrophobic regions, particularly near the N-terminus (residues ~20-40: TTALLIGALVIFAGIVVVLFIFTS), suggesting membrane association

  • Classification as a flotillin-like protein (FloA 2), indicating potential involvement in membrane microdomain organization

  • Potential membrane-spanning domains that would require appropriate environments for proper folding

The UPF0365 protein family remains structurally undercharacterized, but flotillin-like proteins typically feature characteristic domains involved in membrane interactions and protein oligomerization. Comprehensive structural characterization would require advanced techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy.

How does RB6389 expression change through the Rhodopirellula baltica life cycle?

While the search results don't specifically address RB6389 expression changes, Rhodopirellula baltica undergoes a complex life cycle with distinct morphological phases that involves differential expression of numerous proteins:

  • Early exponential phase: Dominated by swarmer and budding cells

  • Transition phase: Shifting to single and budding cells plus rosette formation

  • Stationary phase: Predominantly rosette formations

The transition between these phases involves significant transcriptional changes, with up to 12% of genes showing differential regulation between transition and late stationary phases . Studying RB6389 expression across these stages would provide insights into its potential role in cell morphology changes, adhesion, or stress responses.

What methodological approaches can resolve contradictory findings about RB6389 function?

When confronted with contradictory findings regarding RB6389 function, researchers should implement a systematic contradiction analysis approach:

  • Context-dependent analysis: Examine experimental conditions, including growth phases and environmental factors that might explain different functional observations

  • Relation-type categorization: Classify contradictory findings into excitatory, inhibitory, or other relation types to identify patterns in the contradictions

  • Normalization of claims: Standardize terminology and measurements across studies to enable direct comparison

  • Multi-method validation: Apply complementary techniques (transcriptomics, proteomics, functional assays) to triangulate protein function

This systematic approach helps distinguish genuine biological complexity from methodological artifacts, particularly for proteins like RB6389 whose function may change under different physiological conditions.

How can site-directed mutagenesis enhance understanding of RB6389 function?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships in RB6389:

  • Target selection based on sequence conservation across related proteins

  • Modification of potential membrane-interacting regions to assess localization

  • Mutation of predicted functional motifs

  • Generation of chimeric proteins with related flotillin domains

Drawing from studies of other recombinant proteins, specific mutations can significantly impact expression, folding, and functionality. For example, studies of SARS-CoV-2 RBD protein demonstrated that the E484K mutation interfered with proper disulfide bond formation, resulting in protein retention in the endoplasmic reticulum and reduced secretion . Similar approaches could reveal critical functional regions within RB6389.

What approaches can overcome challenges in expressing membrane-associated proteins like RB6389?

The membrane-associated nature of RB6389 presents specific expression challenges that require methodological solutions:

  • Expression optimization:

    • Lower induction temperatures (15-18°C)

    • Reduced inducer concentrations

    • Specialized E. coli strains designed for membrane protein expression

    • Co-expression with chaperones

  • Solubilization strategies:

    • Screening multiple detergent types and concentrations

    • Systematic buffer optimization

    • Use of amphipols or nanodiscs for downstream applications

  • Fusion partner selection:

    • Solubility-enhancing tags (MBP, SUMO, etc.)

    • Position-specific tag placement (N vs. C-terminal)

    • Inclusion of flexible linkers

Studies of other membrane-associated proteins demonstrate that proper disulfide bond formation and protein folding are critical for successful expression and secretion , suggesting that oxidative environments and specialized folding compartments may benefit RB6389 expression.

What experimental designs can elucidate RB6389's role in the Rhodopirellula baltica life cycle?

A comprehensive experimental design to investigate RB6389's role would include:

  • Temporal expression analysis:

    • Culture R. baltica under controlled conditions through its complete life cycle

    • Collect samples at key morphological transition points

    • Perform quantitative RT-PCR and/or Western blot analysis to track RB6389 expression

    • Correlate expression patterns with morphological changes

  • Localization studies:

    • Generate fluorescently tagged versions of RB6389

    • Perform live-cell imaging throughout the life cycle

    • Track subcellular localization during morphological transitions

  • Gene disruption/overexpression:

    • Create RB6389 knockout or knockdown strains

    • Develop inducible overexpression systems

    • Assess impacts on life cycle progression and morphological development

  • Interactome analysis:

    • Perform pull-down assays at different life cycle stages

    • Identify stage-specific interaction partners using mass spectrometry

    • Validate key interactions through co-immunoprecipitation

This integrated approach would reveal both the expression dynamics and functional significance of RB6389 throughout the Rhodopirellula baltica life cycle, contextualized by the organism's unique morphological transitions described in previous studies .

How can protein-protein interaction networks for RB6389 be established?

Establishing a comprehensive protein-protein interaction network for RB6389 requires a multi-method approach:

  • Affinity purification-mass spectrometry (AP-MS):

    • Use His-tagged RB6389 as bait

    • Perform pull-down experiments under native conditions

    • Identify co-purifying proteins via LC-MS/MS

    • Include appropriate controls and statistical analysis to distinguish specific from non-specific interactions

  • Proximity labeling:

    • Generate RB6389 fusions with BioID or APEX2

    • Express in R. baltica or heterologous systems

    • Identify proximal proteins through streptavidin pull-down and mass spectrometry

  • Crosslinking mass spectrometry:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Identify crosslinked peptides through specialized MS/MS analysis

    • Map interaction interfaces at amino acid resolution

  • Validation studies:

    • Co-immunoprecipitation of key interaction partners

    • Bimolecular fluorescence complementation (BiFC)

    • FRET/FLIM analysis of selected interactions

Integration of these approaches would generate a high-confidence interaction network that could reveal functional modules and cellular pathways involving RB6389.

What emerging technologies show promise for advanced RB6389 characterization?

Several cutting-edge technologies offer new opportunities for RB6389 characterization:

  • Cryo-electron microscopy: Recent advances enable structural determination of membrane proteins in near-native environments, potentially revealing RB6389's membrane interactions and oligomeric states.

  • HDX-MS (Hydrogen-deuterium exchange mass spectrometry): Can map conformational dynamics and ligand-binding regions without requiring protein crystallization.

  • Integrative structural biology: Combining computational modeling with experimental constraints from various techniques to generate comprehensive structural models.

  • Single-molecule techniques: Including TIRF microscopy and optical tweezers to study individual protein behavior and mechanical properties.

  • AlphaFold2 and related AI tools: Deep learning approaches for structure prediction that could generate testable hypotheses about RB6389 function.

These technologies could overcome current limitations in studying membrane-associated proteins and provide unprecedented insights into RB6389 structure and function.

How do the challenges in RB6389 research reflect broader issues in membrane protein characterization?

The challenges encountered in RB6389 research exemplify fundamental issues in membrane protein biology:

  • Expression barriers: Like many membrane proteins, RB6389's hydrophobic regions likely complicate heterologous expression, requiring specialized conditions to achieve proper folding.

  • Structural determination difficulties: Membrane proteins typically resist crystallization and require specialized environments for structural studies.

  • Functional redundancy: As suggested by its flotillin-like classification, RB6389 may participate in redundant systems, complicating phenotypic analysis of gene disruptions.

  • Context-dependent activity: The function of RB6389 likely depends on its lipid environment and interaction partners, necessitating studies under physiologically relevant conditions.

Progress in RB6389 research will both contribute to and benefit from broader advances in membrane protein methodology, highlighting the importance of integrating findings across diverse protein systems and organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.