Recombinant Rhodopseudomonas palustris ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Key Features:

  • UniProt IDs: Q6NBI2 (strain CGA009) and Q2IRA6 (strain HaA2) , reflecting sequence variations between strains.

  • Amino Acid Sequence: 248 residues with conserved proton-conducting residues (e.g., Glu52, Arg169) .

  • Post-Translational Modifications: None reported; produced as a full-length, non-glycosylated polypeptide .

Table 1: Variant Comparison

FeatureQ6NBI2 (CGA009) Q2IRA6 (HaA2)
Transmembrane Domains88
Critical ResiduesGlu52, Arg169Glu52, Arg169
Sequence Divergence4 residues (e.g., T231A)6 residues (e.g., L145S)

Functional Role in ATP Synthesis

  • Proton Translocation: Enables proton flow from the periplasm to the cytoplasm, generating a proton motive force .

  • Autotrophic Growth: Overexpression of ATP synthase subunits correlates with increased ATP production in R. palustris under photoautotrophic conditions .

Expression and Purification

  • Host System: E. coli BL21(DE3) .

  • Yield: >90% purity via immobilized metal affinity chromatography (IMAC) .

  • Storage: Lyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0); stable at -80°C .

Table 2: Physicochemical Properties

ParameterValue
Molecular Weight~27 kDa (calculated)
Isoelectric Point (pI)9.4
StabilizersTrehalose
Reconstitution0.1–1.0 mg/mL in sterile H2_2O

Mechanistic Studies

  • Proton Channel Dynamics: Used to study residue-specific contributions to proton translocation via mutagenesis .

  • Membrane Protein Interactions: Reconstituted into liposomes to analyze F0_0F1_1-ATPase assembly .

Metabolic Engineering

  • Autotrophic Growth Enhancement: Overexpression of ATP synthase subunits (including atpB) in R. palustris increases ATP yield by 30% under CO2_2-fixing conditions .

  • Bioenergy Production: Integrated into synthetic pathways for enhanced ATP supply during biofuel synthesis (e.g., n-butanol) .

Future Directions

  1. Structural Biology: Cryo-EM studies to resolve proton translocation mechanisms.

  2. Biotechnological Optimization: Engineering thermostable variants for industrial ATP-dependent bioconversions.

  3. Pathway Engineering: Coupling ATP synthase activity with carbon fixation modules for synthetic autotrophy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All protein shipments default to standard blue ice packs. If dry ice packaging is preferred, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol utilizes a final glycerol concentration of 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquot the protein to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag selection occurs during production. If you have a specific tag requirement, please inform us and we will prioritize development according to your preference.
Synonyms
atpB; RPB_4571; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain HaA2)
Target Names
atpB
Target Protein Sequence
MAADPIHQFQITKLFSLGHIGGQEIAFTNSSAYMFAAVAIIAVMMLAPGRQLVPGRFQSV AELSYEFVANMIRSTAGKEGLKFFPLVFSLFMFIAVSNLVGIIPYTFTVSSHLIVTVTLA MLVFVTVLVYGLAKNGLKFFKLFVPSGVPIYILPLVVFIEVISFFLKPVSHSVRLFANML AGHIALKVFASFIAMLGALGVVGWVGAVLPLGLTIALTALELLVAFLQAYVFAILTCIYL NDAIHPGH
Uniprot No.

Target Background

Function
A key component of the proton channel, this subunit plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpB) in Rhodopseudomonas palustris?

ATP synthase subunit a (atpB) in R. palustris is a critical component of the membrane-spanning Fo portion of ATP synthase, comprising part of the proton channel. Similar to other bacterial ATP synthases, the R. palustris ATP synthase catalyzes ATP synthesis by utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. The entire ATP synthase complex consists of two linked multi-subunit complexes: the soluble catalytic core (F1) and the membrane-spanning component (Fo) . The atpB subunit specifically contributes to proton translocation across the membrane, which drives the rotational mechanism necessary for ATP synthesis.

What are the structural components of ATP synthase in R. palustris?

The ATP synthase in R. palustris, like in other organisms, consists of two main complexes:

ComplexSubunitsFunction
F1 (catalytic core)α (3), β (3), γ (1), δ (1), ε (1)Catalyzes ATP synthesis
Fo (membrane component)a (atpB), b, cForms proton channel

The catalytic portion contains five different subunits assembled with a specific stoichiometry (3 alpha, 3 beta, and a single representative of gamma, delta, and epsilon), while the proton channel consists of three main subunits (a, b, c) . The a subunit (encoded by atpB) is essential for proton translocation through the membrane domain.

What are the optimal conditions for expressing recombinant R. palustris atpB in E. coli?

When expressing recombinant R. palustris atpB in E. coli, researchers should consider several factors to maximize protein yield and functionality:

  • Expression system selection: The pET expression system with BL21(DE3) E. coli strains is commonly used for membrane proteins like atpB.

  • Induction conditions: Low-temperature induction (16-20°C) after reaching mid-log phase (OD600 0.6-0.8) with 0.1-0.5 mM IPTG helps prevent inclusion body formation.

  • Growth media supplementation: Adding glycerol (0.5-1%) and specific metal ions can enhance proper folding of the protein.

  • Membrane fraction isolation: Gentle lysis methods using specialized detergents like n-dodecyl β-D-maltoside (DDM) or n-octyl glucoside (OG) at concentrations just above their critical micelle concentration are recommended for extraction.

The expression should be verified using Western blotting with antibodies against a fusion tag (e.g., His-tag) or against the atpB protein itself.

How can researchers purify functional recombinant atpB protein while maintaining its native conformation?

Purification of membrane proteins like atpB requires careful consideration of detergent selection and buffer conditions:

  • Solubilization: Use mild detergents like DDM (0.5-1%) or digitonin (1-2%) in buffers containing 150-300 mM NaCl and 20-50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0).

  • Affinity chromatography: If expressing with a His-tag, use Ni-NTA columns with imidazole gradients (10-250 mM) for elution.

  • Size exclusion chromatography: Further purify using gel filtration to isolate properly folded protein complexes.

  • Lipid reconstitution: Consider adding phospholipids (e.g., POPC or a mixture mimicking bacterial membranes) during or after purification at a lipid:protein ratio of 100:1 to 200:1.

  • Stability assessment: Monitor protein stability using circular dichroism (CD) spectroscopy and dynamic light scattering (DLS).

Researchers should conduct functional assays, such as proton translocation measurements, to confirm that the purified protein retains its native activity.

How can site-directed mutagenesis of R. palustris atpB provide insights into proton translocation mechanisms?

Site-directed mutagenesis of conserved residues in the atpB subunit can reveal critical amino acids involved in proton translocation. Researchers should:

  • Target conserved residues: Focus on highly conserved arginine, glutamate, and aspartate residues in the transmembrane regions that may participate in proton transport.

  • Create point mutations: Use overlap extension PCR or commercial mutagenesis kits to create specific amino acid substitutions.

  • Assay proton pumping: Measure proton pumping activity using pH-sensitive fluorescent dyes (e.g., ACMA or pyranine) in reconstituted proteoliposomes.

  • Assess ATP synthesis rates: Quantify ATP synthesis rates in wildtype versus mutant proteins using luciferase-based ATP detection assays.

  • Structural analysis: When possible, combine with structural studies (e.g., cryo-EM) to visualize the effects of mutations on protein conformation.

A comprehensive mutagenesis approach targeting multiple residues can generate a functional map of the proton translocation pathway through the atpB subunit.

What approaches can be used to study the interaction between atpB and other ATP synthase subunits in R. palustris?

Several complementary approaches can elucidate subunit interactions within the ATP synthase complex:

  • Crosslinking studies: Use chemical crosslinkers with varying spacer lengths to identify proximity relationships between subunits.

  • Co-immunoprecipitation: Express tagged versions of atpB and other subunits to pull down interaction partners.

  • FRET analysis: Label subunits with fluorescent tags to measure energy transfer as an indicator of proximity.

  • Surface plasmon resonance (SPR): Measure binding kinetics between purified subunits in real-time.

  • Bacterial two-hybrid assays: Adapt bacterial two-hybrid systems to study membrane protein interactions.

  • Native gel electrophoresis: Use clear native PAGE or blue native PAGE to preserve and analyze intact complexes.

Researchers should validate results using multiple methods, as each approach has limitations when studying membrane protein complexes.

How does ATP production differ between photosynthetic and heterotrophic growth in R. palustris?

R. palustris exhibits remarkable metabolic versatility, with distinct ATP production mechanisms under different growth conditions:

Growth ConditionPrimary ATP SourceATP Synthase RoleRelative ATP Yield
Photosynthetic (anaerobic, light)Cyclic photophosphorylationHigh activityHigh
Heterotrophic (aerobic, dark)Oxidative phosphorylationModerate activityModerate
Anaerobic (dark, with nitrate)Denitrification-linked phosphorylationLow-moderate activityLow-moderate

During photosynthetic growth, cyclic electron flow drives proton pumping without net NADPH production, creating a proton gradient exclusively for ATP synthesis . This allows R. palustris to generate abundant ATP under light conditions. During heterotrophic growth, ATP production relies on respiratory electron transport chains coupled to carbon substrate oxidation, which typically yields less ATP per carbon source compared to photosynthetic growth.

What is the relationship between ATP levels and survival during carbon starvation in R. palustris?

Recent research has established that ATP availability strongly influences R. palustris viability during starvation. Studies comparing energy-replete (light) and energy-depleted (dark) conditions during carbon source depletion revealed:

  • Long-term survival: ATP is crucial for maintaining viability over periods of weeks, with cells in light (ATP-replete) conditions showing significantly higher survival rates compared to dark (ATP-depleted) conditions .

  • Short-term adaptation: R. palustris can survive 12-hour periods of ATP depletion without substantial loss of viability, suggesting an evolutionary adaptation to diurnal cycles .

  • Molecular responses: ATP depletion appears to trigger a shutdown of protein synthesis, likely as an energy conservation strategy .

  • Metabolic remodeling: During ATP limitation, cells may redirect remaining resources toward maintaining membrane integrity and critical cellular functions.

This relationship underscores the central role of ATP synthase activity in bacterial persistence strategies during nutrient limitation.

How conserved is the atpB gene across R. palustris strains, and what are the implications for functional studies?

Analysis of atpB sequences across multiple R. palustris strains reveals important insights for researchers:

  • Core structure conservation: The transmembrane regions and proton channel-forming domains show high sequence conservation (>90% identity) across strains.

  • Strain-specific variations: Some variable regions exist, particularly in cytoplasmic loops, which may reflect adaptation to different ecological niches.

  • Regulatory elements: Promoter regions and transcriptional control elements show greater variation between strains than the coding regions.

When designing experiments, researchers should consider:

  • Using strain-specific primers for PCR amplification

  • Accounting for potential functional differences when comparing results across strains

  • Including multiple reference strains when making physiological claims

The high conservation of functional domains suggests that findings about the fundamental mechanism of proton translocation are likely transferable across strains.

What genetic tools are available for manipulating the atpB gene in R. palustris?

Several genetic tools have been developed or adapted for R. palustris genetic manipulation:

  • Suicide vectors: Plasmids like pJQ200SK or pK18mobsacB can be used for gene replacement via homologous recombination.

  • CRISPR-Cas9 systems: Modified CRISPR systems with codon-optimized Cas9 have been developed for precise genome editing in R. palustris.

  • Transposon mutagenesis: Tn5-based systems can be used for random mutagenesis to identify genetic interactions with atpB.

  • Reporter fusions: Translational fusions with fluorescent proteins (e.g., mCherry) or enzymatic reporters (e.g., lacZ) can monitor atpB expression.

  • Complementation vectors: Broad-host-range plasmids like pBBR1MCS series can express wild-type or mutant atpB for complementation studies.

For successful genetic manipulation:

  • Optimize electroporation conditions (field strength: 12-15 kV/cm, time constants: 4-5 ms)

  • Use appropriate antibiotic selection (kanamycin: 50-100 μg/mL; gentamicin: 10-20 μg/mL)

  • Allow extended incubation times (7-14 days) for colony formation after genetic manipulation

What methods are most effective for measuring atpB-dependent ATP synthesis activity in recombinant systems?

Researchers can employ several complementary approaches to assess ATP synthase activity:

  • Reconstituted proteoliposome assays: Incorporate purified recombinant ATP synthase containing atpB into liposomes and measure ATP synthesis upon establishment of a proton gradient.

    • Buffer conditions: 10 mM MOPS-KOH (pH 7.5), 2.5 mM MgCl₂, 50 mM KCl

    • Establish gradient with acid-base transition (pH 4.5 → 8.0) or K⁺/valinomycin system

    • Measure ATP production using luciferase-based luminescence assays

  • Inverted membrane vesicle assays: Prepare inverted membrane vesicles from E. coli expressing recombinant R. palustris ATP synthase.

    • Generate proton gradient using NADH or succinate as electron donors

    • Measure ATP synthesis rates with varying substrate concentrations

    • Determine kinetic parameters (Km, Vmax) for ATP production

  • Proton pumping measurements: Assess proton translocation using pH-sensitive fluorescent dyes.

    • Use ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine to monitor ΔpH formation

    • Calibrate fluorescence signals with known pH standards

    • Quantify initial rates of proton translocation

Each method has specific advantages, and researchers should use multiple approaches for comprehensive functional characterization.

How does atpB expression and function relate to R. palustris' metabolic adaptability?

R. palustris is renowned for its metabolic versatility, which is reflected in the regulation and function of its ATP synthase components:

  • Growth mode-specific regulation: Expression of atpB and other ATP synthase genes varies between photosynthetic, heterotrophic, and nitrogen-fixing growth conditions, reflecting different ATP demands.

  • Environmental adaptation: Changes in pH, temperature, and salt concentration can alter ATP synthase efficiency, with implications for atpB structure and function in different ecological niches.

  • Integration with electron transport chains: The ATP synthase complex coordinates with different electron transport chains depending on the growth mode:

    • In photosynthetic growth, it couples with cyclic photophosphorylation

    • In heterotrophic growth, it couples with the respiratory chain

    • Under anaerobic conditions, it may couple with alternative electron acceptors

  • Energy conservation strategies: During periods of energy limitation, ATP synthase activity appears to be regulated to maintain minimal ATP levels necessary for survival, as evidenced by R. palustris' ability to survive 12-hour periods of ATP depletion .

Understanding atpB function in the context of these diverse metabolic strategies provides insights into the fundamental bioenergetic principles that enable R. palustris' remarkable ecological adaptability.

What insights can comparative studies of atpB across photosynthetic bacteria provide for bioenergetics research?

Comparative analysis of atpB across diverse photosynthetic bacteria reveals evolutionary adaptations in ATP synthesis mechanisms:

Bacterial GroupatpB CharacteristicsBioenergetic Implications
Purple non-sulfur bacteria (R. palustris)Adaptable to both photosynthetic and respiratory chainsVersatile energy coupling
CyanobacteriaSpecialized interfaces with both respiratory and photosynthetic complexesCoordination between oxygenic photosynthesis and respiration
Green sulfur bacteriaAdaptations for low light environmentsEfficient ATP production at minimal photon flux
HeliobacteriaSimplified interfacesSpecialized for specific ecological niches

Key research insights from comparative studies include:

  • Conserved functional domains: Identification of universally conserved residues essential for proton translocation across all photosynthetic bacteria.

  • Specialized adaptations: Understanding how specific environmental pressures have shaped atpB structure and function in different bacterial lineages.

  • Evolutionary trajectory: Tracing the co-evolution of ATP synthase components with photosynthetic and respiratory complexes.

  • Regulatory divergence: Comparing transcriptional and post-translational regulation of atpB expression across species reveals diverse strategies for controlling cellular bioenergetics.

These comparative approaches not only illuminate the evolution of bioenergetic systems but also identify conserved principles that can inform synthetic biology applications and biotechnological innovations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.