Recombinant Rhodopseudomonas palustris ATP synthase subunit b 2 (atpG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; Rpal_0912; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain TIE-1)
Target Names
atpF2
Target Protein Sequence
MAQGHGDAKGTTAHTEAGGGHKAPFPPFQQETFASQLVSLAIAFVALYLIVSKIALPRVG GVIEERQKTIDGDLAAAQKLKGEADDALKAYEAELADARARAQAIGAETREKLNAQAEAE RKTLEQRLAAKLADAEKTIATTRTAAMGNVRNIASDAASAIVQQLAGVTPDSKAVDSAVD ASLKG
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F1 domain and the membrane-embedded proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. The b' subunit, a component of the F0 channel and part of the peripheral stalk, links F1 to F0. The b' subunit is a divergent and duplicated form of the b subunit found in plants and photosynthetic bacteria.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the genetic organization of ATP synthase genes in Rhodopseudomonas palustris compared to other photosynthetic bacteria?

In photosynthetic bacteria like Rhodobacter capsulatus, the ATP synthase genes are organized into two separate operons. The F1 operon (atpHAGDC) encodes the five subunits of the F1 component (δ, α, γ, β, and ε, respectively) . This organization appears to be unique to the Rhodospirillaceae family. Unlike many other prokaryotes, no F0 genes are found upstream of the atpHAGDC operon in Rhodobacter capsulatus, similar to the situation in Rhodopseudomonas blastica and Rhodospirillum rubrum .

For Rhodopseudomonas palustris specifically, the ATP synthase gene organization follows a similar pattern to other photosynthetic bacteria, though with potential species-specific variations. When studying atpG expression or manipulation, researchers should account for potential operon-level effects and promoter regions, as identified in related organisms through techniques such as primer extension analysis.

How does the sequence of Rhodopseudomonas palustris atpG compare to homologous sequences in other organisms?

The γ subunit (encoded by atpG) shows significant conservation across species, particularly in functional domains. Based on sequence alignments from related photosynthetic bacteria, identity is particularly marked in key sectors. For example, the Rhodobacter capsulatus γ subunit shares high homology with other photosynthetic bacteria (like Rhodospirillum rubrum and Rhodopseudomonas blastica) .

When analyzing R. palustris atpG sequences, researchers should pay special attention to conserved regions that form the central axis of the complex in the form of a coiled-coil helical stem. Notably, unlike higher-plant chloroplasts, R. palustris and other Rhodospirillaceae lack the regulatory cysteine-containing sequence of approximately 40 residues that is responsible for thiol regulation of ATP synthase activity .

What are the optimal expression systems for producing recombinant Rhodopseudomonas palustris ATP synthase subunits?

The choice of expression system depends on research objectives. For structural studies requiring native conformation, homologous expression in R. palustris itself may be advantageous. This can be achieved using broad-host-range vectors like those derived from pRK415, which have been successfully used in related photosynthetic bacteria .

For higher yield production, heterologous expression in E. coli is typically more convenient. When expressing atpG in E. coli, consider these optimization strategies:

  • Use codon-optimized synthetic genes to accommodate the difference in codon usage between E. coli and R. palustris

  • Express with fusion tags (His6, MBP, or GST) to facilitate purification

  • Consider co-expression with chaperones to improve folding

  • Optimize induction conditions (temperature, IPTG concentration, and duration)

If membrane association occurs with your construct, inclusion of detergents during purification may improve yield and stability.

What purification challenges are specific to recombinant ATP synthase subunits from photosynthetic bacteria?

Purification of recombinant ATP synthase subunits presents several challenges. The γ subunit (atpG) forms part of a complex with defined protein-protein interactions that may affect its stability when expressed alone. Researchers should consider:

  • Solubility issues: The γ subunit may form inclusion bodies when overexpressed, necessitating refolding protocols

  • Stability concerns: Without partner subunits, the protein may be unstable; consider co-expression strategies

  • Activity assessment: Individual subunits lack the catalytic activity of the complete complex

A recommended purification workflow includes:

  • Affinity chromatography using engineered tags

  • Ion exchange chromatography to remove contaminants

  • Size exclusion chromatography for final polishing

  • Confirmation of purity by SDS-PAGE and mass spectrometry

To assess proper folding, circular dichroism spectroscopy can verify secondary structure content, which should match predictions based on homology to solved structures.

How can isotope labeling be incorporated into recombinant ATP synthase subunits for structural studies?

For NMR studies or mass spectrometry applications, isotope labeling of recombinant atpG can be achieved through:

  • Expression in minimal media supplemented with 15N-ammonium chloride and/or 13C-glucose

  • Selective labeling of specific amino acids by supplementing defined media with labeled amino acids

  • Deuteration (partial or complete) by expressing in D2O-based media

When designing labeling experiments, consider:

  • Growth rate will typically decrease in minimal media; adjust culture conditions accordingly

  • Expression levels may be lower; scale up culture volumes as needed

  • Verify incorporation efficiency by mass spectrometry before proceeding to structural studies

For hydrogen/deuterium exchange mass spectrometry (HDX-MS) to study conformational dynamics, protocols must be optimized to account for the specific properties of the γ subunit and its potential interaction partners.

What methods are most effective for studying ATP synthase assembly in Rhodopseudomonas palustris?

ATP synthase assembly can be studied using a combination of genetic and biochemical approaches:

  • Blue Native PAGE: To visualize intact complexes and subcomplexes

  • Sucrose gradient ultracentrifugation: To separate complexes based on size

  • Co-immunoprecipitation: To identify interaction partners

  • FRET (Förster Resonance Energy Transfer): To study subunit interactions in vivo

  • Cross-linking mass spectrometry: To map interaction interfaces

For in vivo studies of assembly, fluorescently tagged subunits can be expressed to track localization and complex formation. When designing such constructs, care must be taken to ensure tags do not interfere with assembly or function. Based on studies in related bacteria, researchers should pay particular attention to the potential role of chaperones in the assembly process and consider how the separate operons for F0 and F1 components might be coordinately regulated.

How can site-directed mutagenesis of atpG be used to investigate the functional mechanism of ATP synthase?

Site-directed mutagenesis of atpG is a powerful approach to investigate the rotational catalytic mechanism of ATP synthase. When designing mutagenesis experiments:

  • Target conserved residues identified through sequence alignment across species

  • Focus on residues at interaction interfaces with α and β subunits

  • Consider mutations that might affect the coiled-coil structure of the central stalk

  • Examine regions involved in the proposed rotational mechanism

The complementation approach developed for Rhodobacter capsulatus provides a useful model for R. palustris studies . This involves:

  • Creating a chromosomal deletion of the native gene

  • Providing a complementing plasmid carrying the mutated gene

  • Assessing functional impact through growth phenotypes and biochemical assays

Since ATP synthase is essential for growth in many conditions, lethal mutations can be studied by maintaining the wild-type gene under an inducible promoter while expressing the mutant protein.

What biophysical techniques are most informative for studying the dynamics of the γ subunit in the context of the rotational mechanism?

The γ subunit's central role in the rotational mechanism makes it an excellent target for biophysical studies. The most informative techniques include:

  • Single-molecule FRET: To track conformational changes during catalysis

  • High-speed atomic force microscopy (HS-AFM): To visualize rotation directly

  • Optical or magnetic tweezers: To measure torque generation

  • Molecular dynamics simulations: To model conformational changes at atomic resolution

When designing FRET experiments, strategic placement of fluorophores is critical. Consider:

  • Locations that undergo significant distance changes during rotation

  • Accessibility for labeling (surface-exposed residues)

  • Minimal interference with function

  • Potential reference points on static subunits

These approaches can reveal how the γ subunit transmits conformational changes between F0 and F1 sectors and how mutations affect rotational dynamics. Comparison with the well-studied E. coli and mitochondrial enzymes can highlight unique features of the photosynthetic bacterial ATP synthase.

How does the ATP synthase γ subunit from Rhodopseudomonas palustris compare functionally to those from other photosynthetic organisms?

The γ subunit of ATP synthase shows significant structural conservation across species but with important functional variations. Unlike higher-plant chloroplasts, the γ subunit in R. palustris and other Rhodospirillaceae lacks the regulatory cysteine-containing sequence (approximately 40 residues) responsible for thiol regulation of ATP synthase activity .

This difference has important functional implications:

  • R. palustris ATP synthase activity is not regulated by thiol redox state

  • Alternative regulatory mechanisms likely exist to control enzyme activity in response to cellular energy status

  • The absence of this regulatory segment may affect the conformational dynamics of the rotational mechanism

Researchers investigating R. palustris ATP synthase should design experiments that account for these differences, particularly when extrapolating findings from chloroplast or cyanobacterial systems.

What insights can be gained from studying ATP synthase in metabolically versatile organisms like Rhodopseudomonas palustris?

R. palustris is notable for its metabolic versatility, capable of growing under photoautotrophic, photoheterotrophic, chemoautotrophic, and chemoheterotrophic conditions. This versatility provides unique opportunities to study ATP synthase function under diverse energetic regimes:

  • How ATP synthase activity is regulated under different growth modes

  • The relationship between electron transport chain components and ATP synthase

  • The contribution of ATP synthase to energy homeostasis during metabolic shifts

Similar to approaches used for studying polyhydroxybutyrate production, metabolic modeling can help elucidate how ATP synthase integrates into the organism's broader metabolic network . This can inform experimental design by identifying conditions where ATP synthase activity might be particularly critical or revealing potential synthetic interactions with other pathways.

What evolutionary insights can be derived from comparing ATP synthase operons across different photosynthetic bacteria?

The organization of ATP synthase genes into separate operons for F0 and F1 components appears to be unique to the Rhodospirillaceae family . This distinctive genomic arrangement raises interesting evolutionary questions:

  • How does separate transcriptional control of F0 and F1 components affect assembly coordination?

  • What selective pressures might have led to this operon separation?

  • Are there regulatory elements that ensure stoichiometric production of components?

Comparative genomic analysis across multiple species can identify conserved regulatory elements. Phylogenetic analysis of individual subunits can reveal whether different components evolved at different rates, potentially reflecting distinct functional constraints. These evolutionary insights can inform hypothesis generation about structure-function relationships in the ATP synthase complex.

How can cryo-electron microscopy be applied to study the structure of Rhodopseudomonas palustris ATP synthase?

Cryo-electron microscopy (cryo-EM) has revolutionized structural studies of large complexes like ATP synthase. For R. palustris ATP synthase, researchers should consider:

  • Sample preparation optimization:

    • Detergent selection for membrane extraction

    • Lipid nanodisc reconstitution to maintain native environment

    • Verification of complex integrity by negative stain EM prior to cryo-EM

  • Data collection strategy:

    • Collection of multiple conformational states through biochemical trapping

    • Time-resolved cryo-EM for capturing rotational intermediates

    • Subtomogram averaging for in situ structural studies

  • Analysis approaches:

    • Multi-body refinement to capture flexibility between F0 and F1 sectors

    • Classification to separate discrete conformational states

    • Comparison with existing structures from related organisms

Given the recent advances in identifying auxiliary proteins in photosynthetic complexes (like protein W in the RC-LH1 complex) , researchers should be vigilant for previously unidentified components that might associate with ATP synthase.

What approaches can be used to study the interaction between ATP synthase and the photosynthetic electron transport chain in Rhodopseudomonas palustris?

Understanding the functional coupling between ATP synthase and the photosynthetic electron transport chain requires integrative approaches:

  • Membrane proteomic analysis:

    • Quantitative proteomics to determine stoichiometry

    • Spatial proteomics to map organization within membranes

    • Cross-linking mass spectrometry to identify interaction interfaces

  • Functional coupling studies:

    • Simultaneous measurement of proton gradient formation and ATP synthesis

    • Inhibitor titration experiments to quantify control coefficients

    • Reconstitution systems with defined component ratios

  • Supercomplex investigation:

    • Blue Native PAGE to identify potential supercomplexes

    • Correlation between complex organization and functional efficiency

    • Genetic approaches to perturb supercomplex formation

Drawing parallels from studies of the RC-LH1 complex organization in R. palustris , researchers should investigate whether specific proteins facilitate interaction between ATP synthase and other membrane complexes, potentially creating efficient energy conversion pathways.

How can CRISPR-Cas9 genome editing be optimized for studying ATP synthase genes in Rhodopseudomonas palustris?

CRISPR-Cas9 genome editing offers precise genetic manipulation possibilities for studying ATP synthase. For application in R. palustris:

  • Delivery system optimization:

    • Conjugation-based transfer of CRISPR components

    • Design of broad-host-range vectors expressing Cas9 and guide RNAs

    • Inducible expression systems to control editing timing

  • Editing strategy design:

    • Single nucleotide changes for specific amino acid substitutions

    • Complete gene deletions with complementation strategies

    • Reporter gene fusions for localization and expression studies

  • Screening approaches:

    • Selection methods for essential genes like atpG

    • Phenotypic assays specific to ATP synthase function

    • PCR-based screening followed by sequencing verification

Given that ATP synthase genes are likely essential, strategies similar to those used in Rhodobacter capsulatus could be employed, combining gene transfer agent transduction with conjugation to introduce mutations in essential genes . This approach allows maintenance of functional copies while introducing modified versions for detailed study.

What strategies can address poor expression or solubility of recombinant ATP synthase subunits?

Researchers frequently encounter expression and solubility challenges with ATP synthase subunits. To overcome these issues:

  • For poor expression:

    • Optimize codon usage for the expression host

    • Try different promoter strengths and induction conditions

    • Consider alternative expression hosts (e.g., Rhodopseudomonas-derived expression systems)

    • Evaluate mRNA stability and potential toxicity effects

  • For insolubility:

    • Express fusion partners known to enhance solubility (MBP, SUMO, TrxA)

    • Lower induction temperature (16-20°C) to slow folding

    • Co-express with chaperones specific for membrane or membrane-associated proteins

    • Consider native chemical ligation approaches for difficult domains

  • For both issues:

    • Express individual domains rather than full-length proteins

    • Design constructs based on structural information from homologous proteins

    • Screen multiple construct boundaries to identify stable fragments

When working with atpG specifically, the coiled-coil nature of parts of the protein may lead to aggregation; expressing these regions with stabilizing fusion partners can improve outcomes.

How can researchers address the challenge of studying essential genes like those encoding ATP synthase components?

The essential nature of ATP synthase genes complicates their study. Based on experiences with Rhodobacter capsulatus, where direct deletion of ATP synthase genes was not possible , researchers should consider:

  • Conditional expression systems:

    • Inducible promoters controlling the wild-type gene

    • Temperature-sensitive alleles for reversible inactivation

    • Degron-based approaches for controlled protein degradation

  • Partial complementation approaches:

    • Maintain the chromosomal copy while introducing mutated versions

    • Use gene transfer agent transduction combined with conjugation methods

    • Create merodiploid strains with both wild-type and mutant alleles

  • In vitro reconstitution:

    • Express and purify components separately

    • Reconstitute functional complexes in vitro

    • Study biochemical properties outside the cellular context

  • Suppressor analysis:

    • Identify mutations that compensate for defects in ATP synthase function

    • Map genetic interactions that reveal functional relationships

    • Understand alternative energy conservation mechanisms

The method developed for Rhodobacter capsulatus, which combines gene transfer agent transduction with conjugation, represents a promising approach to construct strains carrying mutations in indispensable genes .

What approaches can help distinguish the specific roles of individual ATP synthase subunits in the context of the complete complex?

Dissecting the roles of individual subunits within the ATP synthase complex requires sophisticated approaches:

  • Hybrid complex creation:

    • Mix and match subunits from different species

    • Introduce tagged versions of specific subunits into native complexes

    • Create chimeric subunits to map functional domains

  • Structure-guided mutational analysis:

    • Target residues at subunit interfaces

    • Create cross-linkable residue pairs to trap specific states

    • Introduce spectroscopic probes at strategic positions

  • Single-molecule approaches:

    • FRET-based conformational sensors

    • Nanodiscs containing individual ATP synthase complexes

    • Tethered complex rotation assays on functionalized surfaces

  • Computational approaches:

    • Molecular dynamics simulations of the complete complex

    • Elastic network models to identify coupled motions

    • Free energy calculations to quantify interaction energetics

When studying subunit b2 specifically, its potential role in dimerization or interaction with other components should be considered, particularly in relation to the organization of ATP synthase within the photosynthetic membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.