Recombinant Rhodopseudomonas palustris ATP synthase subunit b' (atpG)

Shipped with Ice Packs
In Stock

Description

General Information

CharacteristicDescription
OrganismRhodopseudomonas palustris
SynonymsatpF2, atpG, RPA0844, ATP synthase subunit b', ATP synthase F(0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'
FunctionPart of the F0 sector of the ATP synthase complex, which is involved in proton translocation across the membrane .
Protein Length185 amino acids
AA SequenceMAQGHGDAKGTTAHTEAGGGHKAPFPPFQQETFASQLVSLAIAFVALYLIVSKIALPRVGGVIEERQKTIDGDLAAAQKLKGEADDALKAYEAELADARARAQAIGAETREKLNAQAEAE RKTLEQRLAAKLADAEKTIATTRTAAMGNVRNIASDAASAIVQQLAGVTPDSKAVDSAVDASLKG
Predicted partnersatpB, atpC, atpD, atpA, atpH, atpE, atpF2, atpF1

Expression and Purification

Recombinant Rhodopseudomonas palustris ATP synthase subunit b' (atpG) can be expressed in E. coli with an N-terminal His tag for purification purposes . After expression, the protein can be purified using affinity chromatography, taking advantage of the His tag's affinity for nickel or other metal ions .

Role in Metabolic Processes

ATP synthase is crucial for energy conservation in R. palustris, which is metabolically versatile and can grow through various modes, including photoautotrophic, photoheterotrophic, and chemoheterotrophic conditions . In R. palustris, ATP synthase activity is linked to carbon metabolism. For example, the overexpression of transketolase II in R. palustris increases ATP synthesis, indicating a link between carbon metabolism and energy production .

Research Applications

Recombinant Rhodopseudomonas palustris ATP synthase subunit b' (atpG) is used in research applications such as ELISA .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
atpF2; atpG; RPD_0828; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain BisB5)
Target Names
atpF2
Target Protein Sequence
MAEGHGDAKGATAHTAADGGHKAPFPPFQKETFASQLVSLTIAFVALYLIVSKIILPRVG GVIEERQKTIEGDLAAAQKLKGESDDALKAYEAELAQARSRAQAIGAETREKLNAAAEAE RKTLEQRLAAKIADAEKTISATRTAAMGNVRGIASEAAAAIVQQLAGIQPDSKALDSAVN ASIKG
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core; and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. The b' subunit is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0. It is a diverged and duplicated form of the b subunit found in plants and photosynthetic bacteria.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does atpG contribute to the metabolic versatility of Rhodopseudomonas palustris?

The atpG protein, as part of the ATP synthase complex, plays a critical role in energy generation across R. palustris' diverse metabolic modes. R. palustris can grow under phototrophic or chemotrophic conditions, and in aerobic or anaerobic environments .

ATP synthase, including its subunit b', directly contributes to this versatility by:

  • Converting the proton-motive force into ATP during photophosphorylation

  • Supporting various growth states from photoautotrophic to photoheterotrophic metabolism

  • Facilitating energy conversion during different carbon source utilization

Research has shown that seven of eight ATP synthase subunit genes, including atpG, show upregulation during specific growth conditions, such as periplasmic CdS biomineralization, suggesting an accelerated bacterial respiratory efficiency and higher ATP synthesis rate .

What are the sequence variations in atpG across different R. palustris strains?

Significant sequence variations exist between different R. palustris strains. Below is a comparative table of atpG amino acid sequences from two well-studied strains:

StrainLengthUniProt IDKey Sequence FeaturesNotable Differences
TIE-1185 aaB3QF35Hydrophobic transmembrane region; characteristic ATP synthase b' domainContains VDSAVDASLKG C-terminal sequence
BisB18188 aaQ20X00Similar domain architecture with longer sequenceContains ALDRAVDATLKGSQA C-terminal sequence

These variations may reflect adaptations to different ecological niches and metabolic requirements. When designing experiments with recombinant atpG, researchers should carefully consider which strain's sequence is most appropriate for their specific research questions .

What are the optimal expression systems for recombinant R. palustris atpG protein production?

Based on multiple studies, E. coli-based expression systems have proven most effective for recombinant atpG production from R. palustris. When expressing this transmembrane protein, consider the following methodological approaches:

  • Expression vector selection: pBBR1MCS-2 has been successfully used for expression in R. palustris itself , while standard E. coli expression vectors work well for heterologous expression .

  • Codon optimization: Critical for successful expression, as demonstrated in the study by Fixen et al. where direct introduction of non-optimized genes from other organisms into R. palustris failed to produce functional proteins. For example, when expressing C. acetobutylicum genes in R. palustris, codon optimization was essential for successful protein production .

  • Fusion tags: N-terminal His-tags (typically 10xHis) have been successfully employed for purification without compromising protein function .

  • Expression conditions: In vitro E. coli expression systems with induction at lower temperatures (16-20°C) show improved yields of properly folded transmembrane proteins like atpG .

The selection of an appropriate expression system should be guided by the intended experimental application, with heterologous E. coli systems typically preferred for structural studies and homologous R. palustris systems for functional studies.

How can one optimize the purification protocol for recombinant atpG protein?

Purification of recombinant atpG requires special considerations due to its transmembrane nature. A methodological approach based on published protocols includes:

  • Buffer optimization:

    • Use Tris-based buffers (pH 7.5-8.0) with 50% glycerol for storage

    • Include mild detergents (0.1-1% n-Dodecyl β-D-maltoside) during extraction and purification

  • Purification steps:

    • Cell lysis: Gentle disruption using French press or sonication in the presence of protease inhibitors

    • Membrane fraction isolation: Ultracentrifugation (100,000×g, 1h)

    • Solubilization: Carefully titrated detergent concentration

    • Affinity chromatography: Using the N-terminal His-tag

    • Size exclusion chromatography: Final purification step to obtain homogeneous protein

  • Storage considerations:

    • Store at -20°C for short-term or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

The purification yield and protein stability are highly dependent on maintaining proper detergent concentrations throughout the process, as premature detergent removal can lead to protein aggregation.

What quality control tests should be performed on purified recombinant atpG?

A comprehensive quality control pipeline for recombinant atpG should include:

  • Purity assessment:

    • SDS-PAGE analysis: Should show a single band at approximately 20-22 kDa

    • Western blot: Using anti-His antibodies to confirm identity

    • Mass spectrometry: For precise molecular weight determination and sequence verification

  • Structural integrity:

    • Circular dichroism spectroscopy: To confirm proper secondary structure

    • Thermal shift assays: To assess protein stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): To determine oligomeric state

  • Functional analysis:

    • ATP synthase reconstitution assays: To verify the ability to associate with other ATP synthase subunits

    • Proton translocation measurements: To assess functional integration into membranes

  • Storage stability:

    • Regular testing of aliquots over time to determine the practical shelf-life under different storage conditions

Documentation of these quality control parameters is essential for ensuring reproducibility in subsequent experiments.

How can recombinant atpG be used to study the metabolic versatility of R. palustris?

Recombinant atpG serves as a valuable tool for investigating R. palustris' metabolic adaptability. Several research approaches have proven effective:

  • Reconstitution studies: Incorporating purified recombinant atpG into liposomes with other ATP synthase subunits allows for controlled assessment of proton translocation efficiency under different simulated metabolic conditions.

  • Mutagenesis experiments: Site-directed mutagenesis of conserved residues in recombinant atpG, followed by functional complementation in atpG-knockout strains, can reveal structure-function relationships critical to energy coupling mechanisms.

  • Interaction studies: Using tagged recombinant atpG to identify protein-protein interactions within the ATP synthase complex and potentially with other components of energy-generating pathways.

  • Comparative analysis across growth conditions: Quantitative proteomics comparing native atpG expression levels across the diverse metabolic modes of R. palustris (photoheterotrophic, photoautotrophic, chemoheterotrophic) has revealed significant up-regulation of ATP synthase components, including atpG, during specific growth conditions .

These approaches provide insights into how ATP synthase operation adapts to the organism's metabolic versatility, particularly during transitions between different energy-generating pathways.

What role does atpG play in the photosynthetic hydrogen production pathways of R. palustris?

The ATP synthase b' subunit (atpG) is integrally involved in the photosynthetic hydrogen production process in R. palustris through its role in energy metabolism. Research findings reveal:

  • Energy coupling to hydrogen production: ATP generated through photophosphorylation, involving the ATP synthase complex containing atpG, provides energy for nitrogenase-dependent hydrogen production. Flux balance analysis models of R. palustris metabolism demonstrate that ATP synthase activity directly impacts hydrogen production rates .

  • Regulatory relationships: Metabolic flux studies have established that ATP synthase activity and hydrogen production exhibit a complex relationship, with:

    • Maximum hydrogen production occurring at moderate photon flux (10 mmol/h) input

    • Decreased hydrogen production at higher photon fluxes, despite increased ATP synthase activity

    • Antagonistic relationship between hydrogen production and polyhydroxybutyrate (PHB) synthesis

  • Redox balancing: In engineered strains of R. palustris designed for n-butanol production, ATP synthase (including atpG) plays a critical role in maintaining redox balance by providing the necessary energy for metabolic processes when traditional pathways for reducing equivalent disposal (CO₂ fixation, H₂ evolution) are blocked .

The interplay between ATP synthase operation and hydrogen production efficiency provides targets for metabolic engineering to enhance biofuel production capabilities.

How do modifications to atpG affect ATP synthesis efficiency in different metabolic states?

Experimental modifications of atpG have revealed significant impacts on ATP synthesis efficiency across different metabolic conditions:

  • Point mutations in conserved regions: Alterations to the membrane-spanning domain of atpG can significantly affect proton translocation efficiency. Studies on homologous ATP synthase b' subunits suggest that:

    • Mutations in the C-terminal region primarily affect F₁-F₀ coupling

    • Alterations in the transmembrane segment can change proton conductance properties

    • Modifications to interface residues between atpG and other subunits can alter assembly efficiency

  • Expression level modulation: Transcriptomic and proteomic analyses have shown that natural variations in atpG expression correspond to metabolic state transitions:

    • 2-4 fold upregulation during photoheterotrophic growth compared to chemoheterotrophic growth

    • Coordinated expression with other ATP synthase subunits, suggesting complex regulation

  • Strain variations: Different R. palustris strains show natural variations in atpG sequence that correlate with metabolic capabilities:

    • Strain TIE-1 has adaptations for photoautotrophic iron oxidation

    • Strain BisB18 shows optimizations for aromatic compound degradation

    • Strain CGA009 demonstrates enhanced capacity for nitrogen fixation

These findings suggest that atpG modifications could be strategically implemented to optimize energy production for specific biotechnological applications.

How is atpG integrated into genome-scale metabolic models of R. palustris?

Recent genome-scale metabolic models of R. palustris have integrated atpG and ATP synthase function as critical components of energy metabolism networks. The methodological approach includes:

  • Model construction: The comprehensive metabolic model for R. palustris Bis A53 (iDT1294) incorporates ATP synthase reactions with proper gene-protein-reaction (GPR) associations for all subunits, including atpG .

  • Flux balance analysis integration: ATP synthase reactions are typically constrained based on:

    • Experimentally determined ATP maintenance requirements

    • Growth-associated energy demands

    • Photon capture efficiency under different light intensities

  • Multi-omics data integration: Transcriptomic and proteomic data regarding atpG expression under various conditions have been used to refine metabolic models:

    • Artificial neural network models have successfully predicted growth rates using proteomics data that includes ATP synthase components

    • These models achieved 96% predictive accuracy when integrating proteomics data

  • Growth prediction validation: Models incorporating properly parameterized ATP synthase function have predicted growth rates with high accuracy across over 350 different carbon and nitrogen sources under varying oxygen and light conditions .

These integrated models provide platforms for simulating the system-wide effects of atpG modifications and for predicting optimal conditions for specific metabolic outputs such as hydrogen or bioplastic production.

How does atpG expression correlate with other ATP synthase subunits under different growth conditions?

Comprehensive transcriptomic and proteomic analyses have revealed coordinated expression patterns of ATP synthase subunits, including atpG, under varying growth conditions:

  • Coordinated upregulation: Studies show synchronized upregulation of seven of eight ATP synthase subunit genes (atpA, atpC, atpD, atpE, atpF, atpG, and atpH) under specific conditions such as periplasmic CdS biomineralization . This coordinated expression suggests:

    • Common regulatory mechanisms controlling the ATP synthase operon

    • Stoichiometric production of subunits for proper complex assembly

    • Metabolic sensing mechanisms that trigger upregulation

  • Comparative expression levels across growth states: Proteomic analysis of R. palustris grown under six metabolic conditions demonstrated that:

    • Photoautotrophic growth showed highest ATP synthase subunit expression

    • Oxygen-limited conditions showed intermediate expression levels

    • Specific carbon sources, such as benzoate, triggered distinct expression patterns for ATP synthase components

  • Strain-specific variations: Different R. palustris strains show distinctive expression patterns of ATP synthase components when growing on lignin breakdown products, with artificial neural network models identifying ATP synthase subunits among the top twenty proteins influencing growth rates .

These coordinated expression patterns highlight the importance of studying atpG within the context of the complete ATP synthase complex rather than in isolation.

What computational tools are most effective for analyzing atpG within R. palustris metabolic networks?

Several computational approaches have proven valuable for analyzing atpG function within the broader metabolic context of R. palustris:

  • Machine learning approaches: Recent studies have employed artificial neural networks (ANNs) to analyze omics data from R. palustris grown on various substrates:

    • ANNs achieved 94% accuracy with transcriptomics data and 96% with proteomics data

    • These models identified key transport proteins influencing growth rates

    • A reduced ANN model using only eight transport proteins still achieved 86% accuracy for proteomics data

  • Flux balance analysis (FBA): FBA has been successfully applied to study R. palustris metabolism:

    • Models incorporating ATP synthase function predicted hydrogen production rates of 0.68 mmol/h, closely matching experimental values of 0.7 mmol/h

    • FBA revealed substrate conversion efficiency of 56%, near the experimental value of 53%

    • The impact of varying photon flux input on hydrogen production was accurately modeled

  • Integrated multi-omics analysis: Combining transcriptomics, proteomics, and metabolomics data provides comprehensive insights:

    • Statistical analysis revealed nine proteins, including ATP synthase components, with significantly different abundances between aerobic and anaerobic conditions

    • Permutation feature importance analysis identified ATP synthase subunits among the most influential proteins affecting growth rates

These computational tools enable researchers to predict how modifications to atpG might impact system-wide metabolic functions and help design experiments to optimize specific metabolic outputs.

How is atpG being utilized in synthetic biology applications with R. palustris?

Recombinant atpG and ATP synthase engineering are emerging areas in synthetic biology applications involving R. palustris:

  • Metabolic engineering for biofuel production: ATP synthase optimization through targeted modifications to components including atpG has been explored to enhance:

    • n-Butanol production from n-butyrate, achieving concentrations of 1.5 mM at a production rate of 0.03 g L⁻¹ day⁻¹ and selectivity near 40%

    • Hydrogen production through balanced ATP synthesis and electron flow

    • Co-production of valuable compounds through carefully regulated energy distribution

  • Semi-artificial photosynthesis systems: Periplasmic biomineralization studies have shown that ATP synthase components, including atpG, are upregulated in response to semiconductor-bacteria interfaces:

    • Acceleration of bacterial respiratory efficiency

    • Higher rates of ATP synthesis

    • Enhanced electron transfer through engineered pathways

  • Redox-driven obligate reduction pathways: Engineering strategies utilizing ATP from photosynthesis (requiring functional ATP synthase) and excess reducing equivalents have been implemented to drive targeted reduction reactions:

    • Reduced cofactor pools affect the oxidation reactions in butyrate metabolism

    • ATP-dependent processes can be strategically coupled to desired reduction reactions

    • The energetics of these systems depend on properly functioning ATP synthase

These synthetic biology applications leverage the natural metabolic versatility of R. palustris while introducing engineered pathways that depend on ATP synthase function.

What are the most promising approaches for studying atpG protein-protein interactions within the ATP synthase complex?

Several advanced methodological approaches have emerged for investigating atpG protein-protein interactions:

  • Cryo-electron microscopy: This technique provides near-atomic resolution of the complete ATP synthase complex:

    • Enables visualization of atpG interactions with adjacent subunits

    • Allows comparative structural analysis between different conformational states

    • Can reveal strain-specific structural adaptations

  • Crosslinking mass spectrometry (XL-MS): This approach identifies interaction interfaces:

    • MS-cleavable crosslinkers enable identification of interaction sites between atpG and other subunits

    • Quantitative XL-MS can detect changes in interaction dynamics under different metabolic conditions

    • In vivo crosslinking provides insights into native complex assembly

  • Förster resonance energy transfer (FRET): Using fluorescently labeled subunits:

    • Real-time monitoring of subunit association in reconstituted systems

    • Measurement of interaction distances with nanometer precision

    • Detection of conformational changes during ATP synthesis

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique maps structural dynamics:

    • Identifies regions of atpG with altered solvent accessibility upon complex formation

    • Detects conformational changes associated with different functional states

    • Provides insights into the dynamics of protein-protein interfaces

These complementary approaches provide a comprehensive understanding of how atpG integrates into the ATP synthase complex and contributes to its function under various metabolic conditions.

How might CRISPR-Cas9 technologies be applied to study atpG function in R. palustris?

CRISPR-Cas9 genome editing offers powerful approaches for investigating atpG function in R. palustris:

  • Site-directed mutagenesis: Precise modification of conserved residues:

    • Introduction of point mutations to test structure-function hypotheses

    • Creation of temperature-sensitive variants for conditional studies

    • Engineering of tagged versions for in vivo localization and interaction studies

  • Regulated expression systems: Controlling atpG expression dynamics:

    • CRISPRi (CRISPR interference) for tunable repression of atpG expression

    • CRISPRa (CRISPR activation) for enhanced expression under specific conditions

    • Inducible promoter replacements for temporal control of expression

  • Strain engineering: Creating specialized R. palustris variants:

    • Strain libraries with systematically varied atpG sequences

    • Replacement of native atpG with homologs from other organisms

    • Introduction of non-native ATP synthesis pathways

  • High-throughput phenotyping: Large-scale functional assessment:

    • CRISPR-based screening of atpG variants for growth under different metabolic conditions

    • Multiplexed analysis of ATP synthesis efficiency across variant libraries

    • Coupling genome editing with omics approaches to assess system-wide effects

These CRISPR-based approaches enable unprecedented precision in manipulating atpG to elucidate its role within the complex metabolic network of R. palustris.

What are common challenges in expressing functional recombinant atpG and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant atpG:

  • Low expression levels:

    • Challenge: As a transmembrane protein, atpG often expresses poorly in heterologous systems.

    • Solution: Implement codon optimization for the host organism. Studies demonstrate that direct introduction of non-optimized genes fails to produce functional proteins, whereas codon-optimized constructs significantly improve expression .

  • Protein misfolding and aggregation:

    • Challenge: Improper folding leads to inclusion body formation.

    • Solution: Lower induction temperatures (16-18°C), use specialized E. coli strains (C41/C43), and include membrane-mimicking environments during extraction.

  • Limited protein stability:

    • Challenge: Purified atpG tends to aggregate during storage.

    • Solution: Store in buffers containing 50% glycerol at -20°C/-80°C and avoid repeated freeze-thaw cycles. Working aliquots should be kept at 4°C for a maximum of one week .

  • Difficulties in functional validation:

    • Challenge: Confirming proper incorporation into the ATP synthase complex.

    • Solution: Develop reconstitution assays with other purified ATP synthase subunits and measure ATP synthesis activity in proteoliposomes.

  • Strain-specific sequence variations:

    • Challenge: Functional differences between atpG from different R. palustris strains.

    • Solution: Always clearly document which strain's sequence is being used (TIE-1, BisB18, etc.) and consider the specific metabolic characteristics of that strain when interpreting results .

Addressing these challenges requires careful experimental design and often the integration of multiple complementary approaches.

How can researchers troubleshoot issues with atpG incorporation into functional ATP synthase complexes?

When investigating ATP synthase assembly with recombinant atpG, several methodological solutions can address common problems:

  • Incomplete or incorrect assembly:

    • Diagnostic: Size exclusion chromatography reveals multiple peaks or unexpected molecular weights.

    • Solution: Optimize the ratio of ATP synthase subunits during reconstitution. Sequential addition of components often improves assembly compared to simultaneous mixing of all subunits.

  • Lack of proton translocation activity:

    • Diagnostic: ATP-driven proton pumping assays show minimal pH changes in proteoliposomes.

    • Solution: Ensure proper membrane orientation during reconstitution by using a freeze-thaw cycle followed by extrusion. Verify lipid composition is appropriate for R. palustris ATP synthase function.

  • Protein-lipid mismatch:

    • Diagnostic: Circular dichroism spectroscopy shows altered secondary structure compared to native atpG.

    • Solution: Test different lipid compositions that better mimic the R. palustris membrane environment. Consider using lipid extracts from R. palustris for more native-like conditions.

  • Inappropriate detergent selection:

    • Diagnostic: Poor solubilization or loss of secondary structure.

    • Solution: Screen multiple detergents (DDM, LMNG, digitonin) and determine optimal concentrations for each purification step using stability assays.

  • Non-functional protein interactions:

    • Diagnostic: Pull-down assays show binding but activity assays show no functionality.

    • Solution: Implement in vitro complementation assays with native ATP synthase complexes lacking atpG to verify functional integration of recombinant protein.

Systematic troubleshooting with these approaches can significantly improve success rates in functional reconstitution experiments.

What controls should be included when studying atpG in metabolic engineering experiments?

Robust experimental design for atpG studies in metabolic engineering requires comprehensive controls:

  • Expression controls:

    • Empty vector controls to account for plasmid burden effects

    • GFP reporter constructs under identical promoters to verify expression system functionality, as demonstrated in studies using GFPmut2 as a reporter protein

    • Western blots to confirm protein expression levels across experimental conditions

  • Functional controls:

    • ATP synthesis assays with well-characterized ATP synthase inhibitors (oligomycin, DCCD)

    • Membrane potential measurements to verify proton-motive force generation

    • Complementation studies in atpG knockout strains to confirm functional replacement

  • Metabolic controls:

    • Parallel cultures grown with acetate as a positive control for growth comparisons

    • Metabolite analysis to track carbon flux through central metabolism

    • Redox balance assessment through NAD+/NADH ratio measurements

  • Strain variation controls:

    • Wild-type R. palustris strains corresponding to the source of the recombinant atpG

    • Comparisons between aerobic and anaerobic growth conditions

    • Assessment of growth on different carbon sources to establish metabolic baselines

  • Environmental controls:

    • Carefully controlled light intensity for photosynthetic experiments (typically 60W incandescent lamps at standardized distances)

    • Consistent gas composition maintained through proper sparging systems

    • Temperature stability to eliminate confounding thermal effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.