Recombinant Rhodopseudomonas palustris Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Biological Function in β-1,2-Glucan Export and Nitrogen Fixation

NdvA functions as an ATP-binding/permease component of an ATP-binding cassette (ABC) transporter responsible for exporting cyclic β-1,2-glucans. These glucans are essential for:

  • Biofilm formation: Facilitating bacterial adhesion to surfaces.

  • Osmotic adaptation: Maintaining cell turgor under stress.

  • Nitrogenase protection: Shielding nitrogenase enzymes from oxygen damage during nitrogen fixation .

In R. palustris, NdvA operates alongside the Mo-dependent nitrogenase system (nif gene cluster), which is transcriptionally activated under nitrogen-limiting conditions. Notably, strains lacking functional Mo nitrogenase upregulate alternative nitrogenases (vnf, anf) but retain NdvA-dependent glucan export even in high molybdenum environments .

Genomic Context and Evolutionary Homology

The ndvA gene (RPA4265) is part of a 32-gene nif cluster in R. palustris. Key genomic features include:

  • Regulatory elements: A σ54-dependent promoter upstream of ndvA, activated by NifA under nitrogen starvation .

  • Homology: NdvA shares >76% sequence identity with Agrobacterium tumefaciens ChvA, another β-1,2-glucan exporter. Both proteins contain:

    • A nucleotide-binding domain (NBD) for ATP hydrolysis.

    • Transmembrane helices for substrate permeation .

Hydropathy plots reveal conserved transmembrane domains and signal sequences across homologs like HlyB (hemolysin transporter) and Mdr (multidrug resistance protein) .

Applications in Research and Biotechnology

Recombinant NdvA is primarily used to study:

  • ABC transporter mechanisms: Structural analysis of ATP-driven substrate translocation.

  • Nitrogen fixation optimization: Engineering R. palustris for agricultural biofertilizers.

  • Bioremediation: Enhancing biofilm formation for pollutant degradation in wastewater .

Research Challenges and Future Directions

  • Functional redundancy: Overlapping roles of NdvA and other glucan exporters in R. palustris.

  • Crystallography: No resolved 3D structure of NdvA limits mechanistic insights.

  • Metabolic engineering: Leveraging ndvA expression to improve nitrogen-fixing efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own formulations.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
ndvA; RPA4265; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Target Names
ndvA
Target Protein Sequence
MSLFHLYTRVLQLLGKEARLGWILAVANLLLATAQFAEPILFGRIVDVMSGNLATGALVP ETRSPWPLLGAWVGFGLFTIMCSALVALQADRLAHRRRQAVLTSYFEHILQLPISFHTGT HSGRLMKVMLQGTDALWRMWLGFFREHFAAILSLVVLLPLSLYINWRLAILLFVLCIVFT VLTTLVVHKTYGMQGEVEAQYSDLSARASDALGNVALVQSFVRVDAEVQGLRNVSGRLLE AQMPVLSWWALVTVITRASTTITVLSIFALGIYLNQQGLTSVGEIVMFVSFATLLIQRLE QVVNFINNVLMEAPRLREFIAVLDTVPAVRDRADAIDCGRLSGLVEFQNVSFSYDGKRPA IEDLSFTALPGDTIALVGATGAGKSTAIALLHRAFDPQSGVIKVDGMDIRGITLASLRRN IGVVFQEALLFDRSIADNLRVGKPDATPEELRLAAERAQALEFIERSDHKFDTNAGERGR MLSGGERQRLSIARALLKDPPILILDEATSALDAVTEAKLNLALDEVMKGRTTFVIAHRL STIRDATRILVFDNGKVIESGTFDELVARGGAFAQLARAQFMVQESARSAMSSAADAQL
Uniprot No.

Target Background

Function
This protein is involved in the export of beta-(1-->2)glucan. Its transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: rpa:RPA4265

STRING: 258594.RPA4265

Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NdvA protein in Rhodopseudomonas palustris?

The NdvA protein in R. palustris functions as an ATP-binding/permease protein involved in the export of beta-(1-->2)glucan. As part of the ATP-binding cassette (ABC) transporter family, it utilizes energy from ATP hydrolysis to facilitate the transport of specific substrates across cell membranes. In this case, NdvA is specifically responsible for the translocation of beta-(1-->2)glucan polymers, which are important components of bacterial extracellular matrices and can play roles in biofilm formation, cellular protection, and potentially host-microbe interactions. Understanding this protein's function requires consideration of similar transport systems in related organisms while recognizing the specific evolutionary adaptations in R. palustris .

What expression systems are most suitable for recombinant NdvA protein production?

For recombinant production of NdvA, researchers should consider both homologous and heterologous expression systems. For homologous expression, the native R. palustris system can be used, which may better preserve native folding and function. Based on established protocols for related R. palustris proteins, this can be accomplished using suicide plasmids with appropriate homology arms to integrate expression cassettes into the genome or endogenous plasmid of R. palustris .

For heterologous expression, E. coli systems are commonly used, though membrane proteins like NdvA often present challenges due to their hydrophobic domains. Expression optimization should include:

  • Testing multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3))

  • Varying induction conditions (temperature, IPTG concentration)

  • Fusion tag selection (His-tag, MBP, SUMO) to enhance solubility

  • Codon optimization for the host organism

The choice between these systems should be guided by the specific research objectives and downstream applications.

What purification strategies are effective for NdvA isolation?

Purification of NdvA, as an integral membrane protein, requires specialized approaches:

Purification StepMethodConsiderations
Cell LysisMechanical disruption or detergent-based methodsGentle methods preserve protein structure
Membrane IsolationUltracentrifugationTypically 100,000×g for 1h
SolubilizationDetergent screeningDDM, LMNG, or CHAPSO often effective
Affinity ChromatographyNi-NTA (for His-tagged protein)Optimize imidazole concentration
Size ExclusionSuperdex 200Assess protein oligomeric state
Functional VerificationATPase activity assayConfirm protein remains active

When designing purification protocols, researchers should consider that transport proteins like NdvA may require specific lipid environments to maintain their native conformation and functionality. Therefore, including appropriate lipids during purification or reconstituting the purified protein into liposomes or nanodiscs may be necessary for downstream functional studies .

How can researchers verify the proper folding and activity of recombinant NdvA?

Verification of proper folding and activity for recombinant NdvA should include:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to verify compact folding

  • Functional assays:

    • ATP binding assays using fluorescent ATP analogs

    • ATPase activity measurements

    • Transport assays in reconstituted systems (liposomes)

  • Interaction studies:

    • Verification of beta-(1-->2)glucan binding

    • Analysis of potential protein-protein interactions with other components of the transport system

When interpreting results, researchers should remember that RpPat acetylates many acyl-CoA synthetase enzymes in R. palustris , and post-translational modifications like acetylation might influence NdvA activity, though specific information about NdvA acetylation is not directly reported in current literature.

How do mutations in conserved motifs of NdvA affect its ATP binding and hydrolysis capabilities?

ATP-binding/permease proteins like NdvA contain several conserved motifs that are critical for function, including Walker A (P-loop), Walker B, Q-loop, D-loop, and H-loop motifs. Systematic mutational analysis of these motifs can provide insights into:

  • ATP binding dynamics: Mutations in the Walker A motif typically disrupt ATP binding

  • ATP hydrolysis efficiency: Walker B and H-loop mutations often affect hydrolysis steps

  • Coupling mechanism: How ATP hydrolysis energy translates to conformational changes

  • Transport specificity: Substrate binding domains and their relationship to ATP utilization

When designing such experiments, researchers should consider that structural determinants for recognition by protein modifiers may exist far from the actual modification site, as observed with RpPat and its substrates, where regions >20 Å away from the acetylated lysine affected recognition . Similar principles may apply to NdvA's interactions with regulatory partners or substrates.

What approaches are most effective for studying the membrane topology and structure-function relationships of NdvA?

Multiple complementary approaches can elucidate NdvA's membrane topology and structure-function relationships:

These approaches should be integrated to develop a comprehensive understanding of how NdvA's structure enables its function in beta-(1-->2)glucan export. Chimeric protein approaches, similar to those used with RpMatB to identify structural determinants recognized by RpPat , could be valuable for identifying critical domains in NdvA.

How does NdvA interact with other components of the beta-(1-->2)glucan export machinery?

ABC transporters like NdvA typically function as part of larger molecular complexes. Investigating NdvA's protein-protein interactions should include:

  • Co-immunoprecipitation coupled with mass spectrometry to identify interaction partners

  • Bacterial two-hybrid assays to verify direct interactions

  • Förster resonance energy transfer (FRET) to study interactions in native membrane environments

  • Chemical cross-linking followed by mass spectrometry to map interaction interfaces

Researchers should consider that large surface areas of proteins are often involved in recognition by partner proteins, as demonstrated by RpPat's interaction with its substrates . Therefore, interaction studies should account for potential extended interface regions rather than focusing solely on short linear motifs.

What biosafety considerations should researchers address when working with recombinant NdvA constructs?

When working with recombinant NdvA, researchers must adhere to appropriate biosafety guidelines:

  • Under NIH Guidelines Section III-D, experiments using R. palustris as a host-vector system likely require Institutional Biosafety Committee (IBC) approval before initiation .

  • Research involving the cloning and expression of NdvA in various hosts should be evaluated for:

    • Risk group classification of the host organism

    • Potential for altered pathogenicity or virulence

    • Containment requirements based on experimental design

  • If NdvA expression could potentially alter antibiotic resistance profiles, additional oversight might be required under NIH Guidelines Section III-A .

  • Gene editing approaches used for NdvA studies may require specific biosafety considerations based on the technologies employed (CRISPR-Cas9, etc.).

Researchers should consult with their institutional biosafety committee to ensure compliance with current guidelines and regulations before initiating experiments.

What genetic modification techniques are most effective for manipulating ndvA in Rhodopseudomonas palustris?

Based on established techniques for R. palustris, several approaches can be employed to manipulate ndvA:

  • Double homologous recombination: This method has been successfully used in R. palustris using suicide plasmids with homology arms of approximately 1,300-1,500 bp to integrate genetic material into the genome. The process typically involves:

    • Construction of a suicide plasmid with the p15A origin of replication

    • Inclusion of selection markers (e.g., gentamicin resistance)

    • Integration of counterselection markers like sacB for sucrose lethality

  • Plasmid-based expression: For expression from R. palustris' endogenous plasmid, researchers can use:

    • Suicide plasmids with 800-1,000 bp homology arms

    • Expression cassettes with appropriate selection markers

    • Verification of integration via colony PCR and sequencing

  • CRISPR-Cas9 approaches: While not explicitly mentioned in the search results for R. palustris, CRISPR-based methods could potentially be adapted for more precise genetic modifications.

When designing these experiments, researchers should verify that the origin of replication does not function in R. palustris to ensure proper integration rather than plasmid maintenance .

How can researchers optimize heterologous expression systems for functional NdvA production?

Optimizing heterologous expression of membrane proteins like NdvA requires addressing several challenges:

ChallengeStrategyImplementation
Toxicity to hostTight expression controlUse tunable promoters (e.g., araBAD, tac with lac repressor)
Inclusion body formationLower expression temperatureReduce to 16-20°C during induction
Membrane insertionCo-expression of chaperonesInclude SecYEG or YidC for E. coli systems
Protein stabilityFusion partnersN-terminal MBP or SUMO tags can enhance stability
Functional verificationActivity assaysDevelop ATP hydrolysis assays for quality control

For heterologous expression in E. coli, researchers should consider codon optimization based on the host's codon usage bias. Additionally, N-terminal signal sequences may need modification to ensure proper targeting to the host's membrane insertion machinery. Expression levels should be monitored and optimized to balance yield with proper folding and membrane insertion.

What analytical techniques are most informative for characterizing NdvA-substrate interactions?

Several analytical techniques can provide valuable insights into NdvA-substrate interactions:

  • Isothermal titration calorimetry (ITC):

    • Provides thermodynamic parameters (ΔH, ΔS, Kd)

    • Requires purified protein in detergent or reconstituted in nanodiscs

  • Surface plasmon resonance (SPR):

    • Determines binding kinetics (kon, koff)

    • Useful for comparing different beta-(1-->2)glucan substrates

  • Microscale thermophoresis (MST):

    • Requires small sample amounts

    • Useful for screening multiple substrate variants

  • Transport assays in proteoliposomes:

    • Provides functional confirmation of substrate transport

    • Can assess energetic coupling to ATP hydrolysis

  • ATPase activity coupling assays:

    • Measures how substrate binding influences ATP hydrolysis rates

    • Can reveal mechanistic insights into transport cycle

Researchers should consider that substrate recognition by transport proteins often involves multiple protein domains and extensive interaction surfaces, similar to what has been observed with RpPat substrates, where recognition cannot be predicted by a short motif alone .

How can researchers effectively design experiments to investigate post-translational modifications of NdvA?

Post-translational modifications (PTMs) can significantly impact protein function. To investigate potential PTMs of NdvA:

  • PTM identification:

    • Utilize mass spectrometry-based proteomics to identify modifications

    • Multiple digestion enzymes should be used to ensure good peptide coverage

    • Enrichment strategies (TiO2 for phosphopeptides, antibody-based for acetylation) may be necessary

  • Site-directed mutagenesis:

    • Mutate identified PTM sites to non-modifiable residues (e.g., K→R for acetylation sites)

    • Create phosphomimetic mutations (S/T→D/E) to simulate phosphorylation

  • Regulatory enzyme identification:

    • Investigate potential acetyltransferases (like RpPat) that might modify NdvA

    • Screen for kinases that could phosphorylate NdvA

  • Functional impact assessment:

    • Compare ATPase activity between modified and unmodified forms

    • Assess transport efficiency in reconstituted systems

    • Evaluate protein-protein interactions with regulatory partners

Given that RpPat acetylates many acyl-CoA synthetase enzymes in R. palustris , researchers should consider whether NdvA might also be subject to acetylation as a regulatory mechanism.

How can structural insights from NdvA inform the design of novel antimicrobial strategies?

NdvA structural and functional studies could contribute to antimicrobial development through several approaches:

  • Inhibitor development targeting bacterial transport systems:

    • Structural information about NdvA's ATP-binding pocket could guide rational design of inhibitors

    • Understanding the beta-(1-->2)glucan export pathway may reveal vulnerabilities in bacterial cell wall/biofilm formation

  • Comparative analysis with homologous proteins in pathogens:

    • Identification of conserved features that could be targeted across multiple species

    • Development of broad-spectrum inhibitors of bacterial polysaccharide export

  • Biofilm prevention strategies:

    • If beta-(1-->2)glucan contributes to biofilm formation, targeting its export could reduce biofilm-associated infections

    • Combination approaches targeting multiple biofilm components could enhance efficacy

This research direction is particularly relevant considering the demonstrated antimicrobial properties of other R. palustris proteins, such as Atp2, which has been shown to inhibit rice blast fungus by interacting with ribosomal proteins in Magnaporthe oryzae .

What are the challenges in developing high-throughput screening assays for NdvA function?

Developing high-throughput screening (HTS) assays for membrane transporters like NdvA presents several challenges:

ChallengePotential SolutionConsiderations
Membrane protein stabilityDetergent/lipid optimizationScreen multiple conditions systematically
ATP hydrolysis detectionCoupled enzyme assaysAdapt malachite green or luciferase-based methods
Transport activity measurementFluorescent substrate analogsMay require chemical synthesis of specialized probes
Throughput limitationsMiniaturizationAdapt assays to 384 or 1536-well formats
Signal-to-noise ratioOptimized detection methodsConsider FRET-based or bioluminescence approaches

When developing such assays, researchers should emphasize validation with known controls to ensure that the assay accurately reflects protein function. Additionally, counter-screening assays should be implemented to identify false positives, particularly for compounds that might interfere with assay components rather than directly affecting NdvA function.

How might comparative genomics inform our understanding of NdvA evolution and function across bacterial species?

Comparative genomics approaches can provide valuable insights into NdvA's evolution and function:

  • Phylogenetic analysis:

    • Trace the evolutionary history of ndvA and related genes

    • Identify conserved domains versus rapidly evolving regions

    • Map functional diversification across bacterial lineages

  • Genomic context analysis:

    • Examine gene neighborhoods to identify co-evolved functional partners

    • Identify regulatory elements that control ndvA expression

    • Discover potential functionally linked genes through co-occurrence patterns

  • Structural prediction and comparison:

    • Predict structural features based on homology to characterized proteins

    • Compare predicted structures across diverse species

    • Identify structurally conserved regions likely critical for function

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Correlate selection patterns with functional domains

    • Identify potential host-adaptation signatures

These approaches could reveal how NdvA has evolved alongside different beta-(1-->2)glucan synthesis pathways and potentially identify specialized functions in different bacterial species and ecological niches.

What role might NdvA play in bacterial adaptation to different ecological niches?

As a transporter involved in polysaccharide export, NdvA likely contributes to bacterial adaptation in various ecological contexts:

  • Biofilm formation and maintenance:

    • Beta-(1-->2)glucan may contribute to biofilm matrix structure

    • NdvA-mediated export could be regulated in response to environmental cues

    • Biofilm formation provides protection against environmental stresses

  • Host-microbe interactions:

    • Exported polysaccharides can mediate attachment to host surfaces

    • They may also modulate host immune responses

    • Potential role in symbiotic relationships, similar to how other R. palustris proteins like Atp2 can affect plant-microbe interactions

  • Stress response mechanisms:

    • Cell surface modifications can protect against environmental stressors

    • Regulation of NdvA activity might be linked to stress response pathways

    • Polysaccharide export may contribute to desiccation resistance

  • Community dynamics:

    • Exported polysaccharides could influence bacterial community structure

    • Potential role in competitive or cooperative interactions with other microorganisms

Understanding NdvA's role in these ecological contexts requires integrated approaches combining molecular genetics, functional studies, and ecological observations.

What strategies can resolve expression and purification challenges for recombinant NdvA?

When encountering difficulties with NdvA expression and purification, researchers should consider these troubleshooting strategies:

ChallengeDiagnostic ApproachSolution Strategy
Poor expressionWestern blot analysis of whole cellsTry different promoters, strains, or expression conditions
Inclusion body formationFractionation analysisLower induction temperature, use solubility-enhancing tags
Degradation during purificationTime-course stability analysisInclude protease inhibitors, optimize buffer conditions
Low yield from membrane fractionDetergent screeningTest different detergents for extraction efficiency
Loss of activityATPase activity measurementsOptimize lipid composition, consider native purification
Aggregation during concentrationDynamic light scatteringAdd stabilizing agents (glycerol, specific lipids)

For membrane protein work, maintaining the cold chain throughout purification is critical. Additionally, researchers should consider that membrane proteins often require specific lipid environments for stability and function, so including appropriate lipids during purification may improve results.

How can researchers effectively design mutagenesis studies to map NdvA functional domains?

Strategic approaches to mutagenesis studies for NdvA include:

  • Alanine-scanning mutagenesis:

    • Systematically replace residues in predicted functional regions with alanine

    • Assess impact on expression, ATP binding/hydrolysis, and transport activity

    • Focus on conserved motifs first (Walker A/B, Q-loop, etc.)

  • Conservation-guided mutagenesis:

    • Target highly conserved residues identified through sequence alignment

    • Compare effects of conservative versus non-conservative substitutions

    • Correlate conservation patterns with functional importance

  • Chimeric protein construction:

    • Create chimeras between NdvA and related transporters with different specificities

    • Map regions responsible for substrate selectivity

    • This approach has been successful with other R. palustris proteins, as demonstrated in studies with RpMatB chimeras

  • Domain swapping:

    • Exchange nucleotide-binding domains or transmembrane domains with related transporters

    • Assess functional compatibility and determinants of specificity

    • Identify critical interfaces between protein domains

These approaches should be combined with functional assays to correlate structural features with specific aspects of NdvA function.

What experimental controls are critical for validating NdvA functional assays?

Robust experimental controls are essential for reliable NdvA functional characterization:

  • Negative controls:

    • ATPase-deficient mutants (Walker A/B mutations)

    • Heat-denatured protein preparations

    • Empty liposomes/expression vectors

  • Positive controls:

    • Well-characterized related ABC transporters

    • Native NdvA purified from R. palustris

    • Known substrates with established transport parameters

  • Specificity controls:

    • Structurally similar non-substrate molecules

    • Competitive inhibitors if available

    • ATP analogs with varying hydrolysis properties

  • System validation:

    • Verification of protein orientation in reconstituted systems

    • Confirmation of membrane integrity in transport assays

    • Demonstration of ATP-dependent activity

  • Data validation:

    • Technical and biological replicates

    • Statistical analysis of variability

    • Dose-response relationships for substrates and inhibitors

Proper controls will help distinguish specific NdvA-mediated activities from non-specific effects or experimental artifacts.

How can contradictory experimental results about NdvA function be reconciled?

When faced with contradictory results in NdvA research, consider these analytical approaches:

  • Experimental condition differences:

    • Systematically compare buffer compositions, detergents, and lipids used

    • Evaluate temperature, pH, and salt concentration variations

    • Assess protein preparation methods and purity

  • Strain and construct variations:

    • Compare genetic backgrounds of expression hosts

    • Examine differences in protein constructs (tags, fusion partners)

    • Assess potential effects of codon optimization or expression systems

  • Measurement technique limitations:

    • Evaluate sensitivity and specificity of different assay methods

    • Consider potential artifacts introduced by detection systems

    • Implement orthogonal measurement approaches

  • Integrative analysis:

    • Develop a model that accommodates seemingly contradictory data

    • Consider contextual factors (e.g., regulatory mechanisms)

    • Design critical experiments to distinguish between competing hypotheses

This process mirrors approaches used in other complex research areas, such as understanding the substrate specificity of RpPat, where multiple factors beyond simple sequence motifs were found to influence recognition .

How might NdvA research inform synthetic biology applications in Rhodopseudomonas palustris?

NdvA research can contribute to synthetic biology applications in several ways:

  • Export system engineering:

    • Modification of NdvA specificity could enable export of novel polysaccharides

    • Engineering controlled export systems for biotechnological applications

    • Integration with synthetic pathways for novel biomaterials production

  • Biosensor development:

    • Using NdvA as a component in whole-cell biosensors

    • Engineering feedback mechanisms between environmental sensing and polysaccharide export

    • Creating responsive biofilm formation systems

  • Metabolic engineering platforms:

    • Integration with the existing synthetic biology tools for R. palustris described in the literature

    • Utilizing the established transformation and genome integration methods

    • Combining with expression control systems for regulated polysaccharide production

  • Chassis development:

    • Optimizing R. palustris as a synthetic biology platform

    • Enhancing its utility for diverse biotechnological applications

    • Leveraging its metabolic versatility for sustainable bioprocessing

These applications would build upon established genetic modification techniques for R. palustris, including the use of suicide plasmids with homology arms for genome integration .

What computational approaches can best predict NdvA structure and substrate interactions?

Modern computational approaches offer powerful tools for NdvA structure prediction and analysis:

  • AlphaFold2 and RoseTTAFold:

    • State-of-the-art protein structure prediction

    • Particularly valuable for membrane proteins with limited experimental structural data

    • Can generate models of different conformational states

  • Molecular dynamics simulations:

    • Analysis of protein dynamics in membrane environments

    • Investigation of conformational changes during the transport cycle

    • Prediction of substrate binding modes and energetics

  • Substrate docking:

    • Prediction of beta-(1-->2)glucan binding sites

    • Evaluation of binding energetics and specificity determinants

    • Virtual screening of potential inhibitors

  • Coevolution analysis:

    • Identification of co-evolving residue pairs

    • Prediction of functionally important interactions

    • Validation of structural models based on evolutionary constraints

  • Machine learning approaches:

    • Integration of multiple data types for functional prediction

    • Classification of potential substrates based on physicochemical properties

    • Prediction of critical residues for function

These computational approaches can guide experimental design and help interpret experimental results, particularly when integrated with biochemical and structural studies.

How does NdvA compare to ATP-binding cassette (ABC) transporters in other bacterial species?

Comparative analysis of NdvA with other ABC transporters provides evolutionary and functional insights:

  • Structural organization:

    • ABC transporters typically contain nucleotide-binding domains (NBDs) and transmembrane domains (TMDs)

    • NdvA likely follows the canonical organization but may have specific adaptations for beta-(1-->2)glucan export

    • Comparison with well-characterized systems like maltose transporters can reveal conserved and divergent features

  • Mechanistic conservation:

    • ATP-binding and hydrolysis mechanisms are generally conserved across ABC transporters

    • Conformational changes coupling ATP hydrolysis to transport likely follow similar principles

    • Specific substrate recognition mechanisms would be unique to NdvA

  • Regulatory mechanisms:

    • Comparison of post-translational modification patterns across ABC transporters

    • Evaluation of potential acetylation by proteins like RpPat, which is known to acetylate multiple enzymes in R. palustris

    • Analysis of transcriptional and translational control mechanisms

  • Evolutionary relationships:

    • Placement of NdvA within the broader ABC transporter phylogeny

    • Identification of closest homologs and potential functional analogs

    • Tracking of evolutionary innovations specific to polysaccharide exporters

This comparative analysis can provide insights into both conserved mechanisms and specialized adaptations in NdvA.

What interdisciplinary collaborations would most benefit NdvA research?

Effective NdvA research would benefit from strategic collaborations across multiple disciplines:

  • Structural biology:

    • Expertise in membrane protein crystallography or cryo-EM

    • Access to advanced synchrotron or electron microscopy facilities

    • Experience with challenging membrane protein structures

  • Synthetic chemistry:

    • Development of substrate analogs and activity probes

    • Synthesis of potential inhibitors

    • Creation of modified beta-(1-->2)glucan variants

  • Systems biology:

    • Integration of NdvA function into broader cellular networks

    • Metabolic modeling of polysaccharide production and export

    • Multi-omics approaches to understand regulatory networks

  • Microbial ecology:

    • Investigation of NdvA's role in natural environments

    • Study of biofilm formation in environmentally relevant conditions

    • Analysis of polysaccharide functions in microbial communities

  • Computational biology:

    • Advanced molecular dynamics simulations in membrane environments

    • Protein structure prediction and refinement

    • Virtual screening for potential modulators of NdvA function

These collaborations should be structured around shared research questions and complementary expertise, with clear communication and data-sharing protocols.

How should researchers design a comprehensive research program to characterize NdvA function?

A strategic research program for NdvA characterization might follow this progression:

  • Initial characterization phase (0-12 months):

    • Gene cloning and expression system optimization

    • Development of purification protocols

    • Basic functional assays (ATPase activity, substrate binding)

    • Preliminary structural characterization

  • Detailed mechanistic studies (12-24 months):

    • Site-directed mutagenesis of key residues

    • Transport assays in reconstituted systems

    • Conformational dynamics studies

    • Interaction mapping with other proteins

  • Physiological context (24-36 months):

    • In vivo studies using gene deletions or mutations

    • Analysis of beta-(1-->2)glucan production and localization

    • Environmental response studies

    • Biofilm formation analysis

  • Applied research directions (36-48 months):

    • Exploration of biotechnological applications

    • Investigation of potential antimicrobial targets

    • Development of modified NdvA variants with altered specificity

This program should incorporate appropriate biosafety considerations per NIH Guidelines , particularly if the research involves recombinant DNA technology or potential alterations to antibiotic resistance profiles.

What research questions about NdvA would benefit from workshop-style collaborative problem-solving?

Complex research questions about NdvA could benefit from structured collaborative workshops:

  • Structural determination challenges:

    • Bringing together experts in different structural biology techniques

    • Addressing membrane protein crystallization or cryo-EM sample preparation issues

    • Integrating computational and experimental approaches

  • Transport mechanism controversies:

    • Reconciling different models of ATP-coupled transport

    • Addressing contradictory experimental findings

    • Designing definitive experiments to distinguish between mechanisms

  • System integration questions:

    • Understanding how NdvA functions within the broader context of cellular physiology

    • Mapping interactions with other cellular components

    • Developing integrated models of polysaccharide synthesis and export

  • Technical bottlenecks:

    • Optimizing challenging purification or expression protocols

    • Developing improved functional assays

    • Addressing reproducibility issues across laboratories

These workshops could follow the format described in search result , where participants define research questions collaboratively, prioritize them, and develop action plans for addressing them.

How can researchers effectively communicate complex findings about NdvA to diverse scientific audiences?

Effective communication of NdvA research requires tailored approaches for different audiences:

  • For structural biologists:

    • Emphasize unique structural features compared to other ABC transporters

    • Provide detailed analysis of conformational states

    • Relate structure to mechanistic hypotheses

  • For microbiologists:

    • Focus on physiological roles in R. palustris

    • Discuss implications for biofilm formation and bacterial adaptation

    • Relate to broader bacterial physiology

  • For biochemists:

    • Highlight catalytic mechanisms and kinetic parameters

    • Discuss protein-substrate interactions

    • Address energetic coupling between ATP hydrolysis and transport

  • For synthetic biologists:

    • Emphasize potential applications in engineered systems

    • Discuss modularity and parts compatibility

    • Present as components for synthetic pathways

  • For interdisciplinary audiences:

    • Begin with accessible overviews before diving into specifics

    • Use visual representations of complex processes

    • Clearly explain the significance of findings for different fields

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.