Recombinant Rhodopseudomonas palustris Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biological Function

PlsY catalyzes the first step in phospholipid biosynthesis by transferring an acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid (LPA) . This reaction is part of the PlsX/PlsY pathway, a conserved bacterial lipid synthesis mechanism distinct from the acyl-CoA-dependent PlsB pathway . In R. palustris, PlsY operates under anaerobic conditions and integrates with fatty acid metabolism networks .

Lipid Metabolism Studies

PlsY is used to investigate bacterial phospholipid biosynthesis, particularly in organisms lacking the PlsB pathway (e.g., Streptomyces) . Its role in converting acyl-phosphate to LPA provides insights into energy-dependent lipid synthesis .

Metabolic Engineering

In R. palustris, recombinant PlsY supports strain optimization for biofuel production. For example:

  • Overexpression of lipid synthesis genes (plsY, fix clusters) enhances hydrogen and fatty acid yields during photofermentation .

  • Deletion of regulatory genes (e.g., badM) combined with PlsY activity enables degradation of halogenated aromatics .

Production and Purification Protocol

  1. Expression: plsY is cloned into E. coli vectors (e.g., pBBRMCS-5) under a T7/lac promoter.

  2. Purification: Nickel affinity chromatography isolates His-tagged protein .

  3. Formulation: Lyophilized in Tris/PBS buffer with 6% trehalose .

  4. Reconstitution: Resuspend in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

Stability and Handling

  • Storage: Avoid repeated freeze-thaw cycles; aliquot for multiple uses .

  • Activity Loss: <10% after 6 months at -80°C .

Comparative Analysis with Homologs

FeatureR. palustris PlsY Streptococcus PlsY
SubstrateAcyl-phosphateAcyl-phosphate
PathwayPlsX/PlsYPlsX/PlsY
Membrane AssociationPredicted integral membraneConfirmed transmembrane helices
Industrial UseBiofuel production Antibiotic target

Research Limitations

  • Oxygen Sensitivity: Activity assays require anaerobic conditions .

  • Solubility Issues: Membrane-bound nature complicates crystallization .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; RPA3119; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Target Names
plsY
Target Protein Sequence
MMIGIYIAALVIGYLFGSIPFGLILTKIAGTQDLRSIGSGNIGATNVLRTGRKGLAAATL LLDALKGTAAVIVAAYLASGTDAIAANAAMLAALGAFLGHLFPVWLKFKGGKGVAVYIGV LIGLFWPAAVVFCIMWLATAFTSRYSSLSALVASFVTPIFLWWFGHDSLASLFAVLTLLL FWMHRENIKRLQAGTESKIGQKK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to produce lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: rpa:RPA3119

STRING: 258594.RPA3119

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) in Rhodopseudomonas palustris?

Glycerol-3-phosphate acyltransferase (plsY) in Rhodopseudomonas palustris is a critical enzyme that catalyzes the first step in phospholipid biosynthesis, specifically the acylation of glycerol-3-phosphate to form lysophosphatidic acid. This reaction represents a rate-limiting step in the de novo pathway of glycerolipid synthesis. The enzyme belongs to the broader GPAT family, which in mammals comprises four distinct isoforms with varying subcellular localizations and substrate preferences . In R. palustris, plsY plays a fundamental role in membrane phospholipid synthesis and influences cellular metabolism, making it an important target for metabolic engineering and fundamental research on bacterial lipid biosynthesis.

How does plsY differ structurally and functionally from other acyltransferases?

PlsY belongs to a distinct class of acyltransferases that differs from the typical GPAT enzymes found in many organisms. Unlike mammalian GPATs that are classified into mitochondrial (GPAT1, GPAT2) and endoplasmic reticulum-associated (GPAT3, GPAT4) groups , bacterial plsY is typically a membrane-associated protein with unique structural features.

The functional differences include:

  • Substrate specificity: PlsY preferentially utilizes acyl-ACP (acyl carrier protein) as the acyl donor rather than acyl-CoA, which is commonly used by mammalian GPATs

  • Catalytic mechanism: PlsY employs a unique catalytic mechanism involving conserved residues in its active site

  • Regulatory control: Unlike mammalian GPATs that are regulated through complex signaling networks involving insulin and other hormones, bacterial plsY regulation is primarily tied to cellular growth requirements and environmental conditions

These differences make plsY an attractive target for antimicrobial development and metabolic engineering applications, particularly when expressed recombinantly in R. palustris.

What is the optimal protocol for transforming R. palustris with recombinant plsY constructs?

The transformation of R. palustris with recombinant plsY constructs is most effectively accomplished through bacterial conjugation rather than direct transformation methods. Based on established protocols, the following methodology is recommended:

  • Vector Construction:

    • Amplify the plsY gene from R. palustris genomic DNA using high-fidelity polymerase

    • Clone the amplified gene into an appropriate shuttle vector (e.g., pBBR1MCS-5)

    • Transform the construct into E. coli S17-1 (donor strain for conjugation)

  • Conjugation Procedure:

    • Grow E. coli S17-1 containing the plsY construct in LB medium with appropriate antibiotics

    • Grow recipient R. palustris strain in rich medium under photoheterotrophic conditions

    • Mix donor and recipient cultures (ratio 1:3) and spot on a non-selective medium

    • Incubate for 24-48 hours under microaerobic conditions

    • Resuspend and plate on selective medium with antibiotics that select for R. palustris transconjugants

  • Verification of Transformants:

    • Screen colonies using colony PCR targeting the inserted plsY gene

    • Verify plasmid integrity through restriction digestion of extracted plasmid

    • Confirm expression using RT-PCR or Western blotting techniques

This conjugation-based approach has been successfully used for introducing various genetic constructs into R. palustris strains, with transformation efficiencies typically ranging from 10^-5 to 10^-7 per recipient cell .

How can enzyme activity of recombinant plsY be accurately measured in R. palustris extracts?

Accurate measurement of recombinant plsY enzyme activity in R. palustris extracts requires careful preparation and specific assay conditions:

  • Cell Extract Preparation:

    • Harvest R. palustris cells during exponential growth phase

    • Wash cells with buffer (typically 50 mM Tris-HCl, pH 7.5, containing 10% glycerol and 1 mM DTT)

    • Disrupt cells by sonication or French press under anaerobic conditions

    • Remove cell debris by centrifugation (10,000 × g, 20 min)

    • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 h)

    • Resuspend membrane fraction in buffer containing 0.5-1% detergent (e.g., Triton X-100)

  • Enzyme Activity Assay:

    • Prepare reaction mixture containing:

      • Glycerol-3-phosphate (0.5-1 mM)

      • Acyl-ACP or acyl-CoA donor (50-200 μM)

      • Buffer (50 mM Tris-HCl, pH 7.5)

      • MgCl₂ (5-10 mM)

    • Incubate at 30°C for 15-30 minutes

    • Stop reaction with chloroform:methanol (2:1)

    • Extract lipids and analyze by thin-layer chromatography or LC-MS/MS

  • Data Analysis:

    • Calculate specific activity as nmol product formed per min per mg protein

    • Determine kinetic parameters (Km, Vmax) using Michaelis-Menten analysis

    • Compare activity between wild-type and recombinant strains

The sensitivity of this assay can be enhanced by using radiolabeled substrates or fluorescent derivatives of glycerol-3-phosphate, allowing detection of products at nanomolar concentrations.

What controls should be included when studying recombinant plsY in R. palustris?

Robust experimental design for studying recombinant plsY in R. palustris requires comprehensive controls:

Implementing these controls helps distinguish specific plsY-related effects from general physiological responses and ensures reproducibility of results across different experimental conditions .

How does the expression of recombinant plsY affect the membrane phospholipid composition of R. palustris?

The expression of recombinant plsY in R. palustris significantly impacts membrane phospholipid composition through several mechanisms:

  • Altered Phospholipid Classes Distribution:
    Overexpression of plsY typically results in elevated levels of phosphatidic acid (PA) and its downstream products, particularly phosphatidylethanolamine (PE) and phosphatidylglycerol (PG), which are major phospholipids in bacterial membranes. This shift can be quantitatively measured using lipidomics approaches.

  • Changes in Fatty Acid Composition:
    Recombinant plsY expression often leads to altered acyl chain incorporation patterns, depending on the enzyme's substrate specificity. This may manifest as changes in:

    • Saturation levels (saturated vs. unsaturated fatty acids ratio)

    • Chain length distribution (C16:0, C18:0, C18:1, etc.)

    • Cyclopropane fatty acid content

  • Membrane Physical Properties:
    The alterations in phospholipid composition directly affect:

    • Membrane fluidity

    • Phase transition temperature

    • Permeability to small molecules

    • Protein-lipid interactions affecting membrane protein function

When analyzing these effects, researchers should employ comprehensive lipidomic analyses, including LC-MS/MS and GC-MS techniques, to characterize both the headgroup and fatty acyl chain profiles of membrane phospholipids. Additionally, biophysical techniques such as differential scanning calorimetry and fluorescence anisotropy measurements can provide insights into the functional consequences of these compositional changes on membrane properties.

What gene knockout approaches are most effective for studying plsY function in R. palustris?

Studying plsY function in R. palustris through gene knockout approaches requires strategic methodologies due to the potential essentiality of this enzyme. The following approaches have proven most effective:

  • Suicide Vector-Based Homologous Recombination:
    This approach utilizes plasmids that cannot replicate in R. palustris but can integrate into the genome through homologous recombination. The methodology involves:

    • Construction of a suicide plasmid containing flanking regions of the plsY gene

    • Introduction of antibiotic resistance cassette to replace the plsY coding sequence

    • Transfer of the construct into R. palustris via conjugation

    • Selection for single crossover events (plasmid integration)

    • Counter-selection for double crossover events (gene replacement)

    This method has been successfully employed for gene knockouts in R. palustris, following established protocols .

  • Conditional Knockout Systems:
    Due to the potential essentiality of plsY, conditional knockout approaches may be necessary:

    • Introducing an inducible promoter upstream of the native plsY gene

    • Creating an inducible antisense RNA system to modulate plsY expression

    • Employing a complementation-based approach with temperature-sensitive plasmids

  • CRISPR-Cas9 Based Approaches:
    Although less established in R. palustris compared to model organisms, CRISPR-Cas9 systems are being adapted for photosynthetic bacteria:

    • Design of specific sgRNAs targeting plsY

    • Codon-optimized Cas9 expression for R. palustris

    • Repair templates for precise genetic modifications

The effectiveness of these approaches can be significantly enhanced by first creating a merodiploid strain containing a second copy of plsY under an inducible promoter, thereby allowing manipulation of the native gene while maintaining cell viability through the inducible copy.

How can multi-omics approaches be integrated to understand the metabolic impact of recombinant plsY expression in R. palustris?

Integrating multi-omics approaches provides a comprehensive understanding of how recombinant plsY expression affects R. palustris metabolism:

  • Genomics:

    • Whole genome sequencing to identify potential compensatory mutations

    • Analysis of genomic stability with recombinant plsY expression

    • Monitoring potential plasmid rearrangements or instability

  • Transcriptomics:

    • RNA-seq analysis to identify differentially expressed genes

    • Targeted RT-qPCR of key metabolic genes

    • Analysis of operons associated with lipid metabolism

  • Proteomics:

    • Quantitative proteomics (iTRAQ or TMT) to measure protein abundance changes

    • Phosphoproteomics to detect altered signaling pathways

    • Membrane protein enrichment for detailed analysis of membrane remodeling

  • Metabolomics:

    • Targeted analysis of acyl-ACP/acyl-CoA pools

    • Global metabolite profiling to identify metabolic bottlenecks

    • Flux analysis using 13C-labeled substrates

  • Lipidomics:

    • Comprehensive phospholipid profiling

    • Analysis of lipid species distribution

    • Membrane fluidity and organization studies

  • Data Integration Framework:

The multi-omics data can be integrated using computational approaches such as:

Integration LevelMethodsOutcomes
Statistical correlationPearson/Spearman correlation, PCAIdentifies co-regulated biomolecules
Network analysisWGCNA, Bayesian networksReveals regulatory relationships
Pathway mappingKEGG, BioCyc annotationsPlaces changes in biochemical context
Constraint-based modelingFlux Balance AnalysisPredicts metabolic flux distributions
Machine learningRandom forests, neural networksIdentifies complex patterns in data

This integrated approach enables identification of both direct effects of plsY overexpression on lipid metabolism and secondary adaptations across the metabolic network, providing a systems-level understanding of R. palustris physiology under these conditions.

What are common challenges in expressing active recombinant plsY in R. palustris and how can they be addressed?

Expressing active recombinant plsY in R. palustris presents several challenges that researchers frequently encounter:

  • Low Expression Levels:

    • Challenge: Poor transcription or translation efficiency of heterologous plsY

    • Solution: Optimize codon usage for R. palustris; employ stronger, well-characterized promoters like those from puc or puf operons; utilize optimized ribosome binding sites; consider using the pBBR1MCS vectors which have been shown to provide good expression levels in R. palustris

  • Protein Misfolding/Inactivity:

    • Challenge: Recombinant plsY may fold incorrectly or lack proper post-translational modifications

    • Solution: Express with fusion tags that enhance folding (MBP, thioredoxin); adjust growth temperature to 25-28°C during expression phase; co-express with appropriate chaperones if needed

  • Cellular Toxicity:

    • Challenge: Overexpression of plsY may disrupt membrane homeostasis or lipid metabolism

    • Solution: Use inducible expression systems with titratable inducers; create expression constructs with attenuated ribosome binding sites; balance expression through promoter engineering

  • Enzyme Instability:

    • Challenge: Rapid degradation of recombinant plsY protein

    • Solution: Co-express with protease inhibitors; add stabilizing agents like glycerol (10-20%) to buffers; maintain strict anaerobic conditions during purification

  • Plasmid Instability:

    • Challenge: Loss of expression plasmid during extended cultivation

    • Solution: Maintain selective pressure through appropriate antibiotics; consider integration into the genome; use plasmids known to be stable in R. palustris like pBBR1MCS-5

Systematic optimization of these parameters, combined with validation of enzyme activity at each step, significantly improves the chances of obtaining functionally active recombinant plsY in R. palustris.

How can researchers optimize growth conditions for R. palustris expressing recombinant plsY?

Optimizing growth conditions for R. palustris expressing recombinant plsY requires careful consideration of multiple parameters:

  • Light Intensity and Quality:

    • Optimal Range: 2000-4000 lux for photoheterotrophic growth

    • Recommendation: Use LED lights with peaks at 590 nm and 870 nm to match bacteriochlorophyll absorption

    • Adjustment: If plsY expression affects photosynthetic membrane composition, gradual light adaptation may be necessary

  • Temperature Management:

    • Optimal Range: 28-30°C for growth, consider lowering to 25°C during induction phase

    • Critical Factor: Temperature stability (±1°C) is crucial for membrane lipid composition

    • Monitoring: Track growth rates at different temperatures to determine strain-specific optima

  • Carbon Source Selection:

    • Preferred Sources: Acetate, malate, or succinate at 10-20 mM

    • Considerations: plsY expression may alter fatty acid metabolism, requiring adjustment of carbon sources

    • Strategy: Test a matrix of carbon sources and concentrations to determine optimal combination

  • Oxygen Levels:

    • Condition Options: Anaerobic phototrophic, microaerobic, or aerobic dark growth

    • Recommendation: Maintain consistent oxygen conditions; avoid fluctuations

    • Method: Use defined headspace:culture ratios in sealed vessels with appropriate gas mixtures

  • pH Buffering:

    • Optimal Range: pH 6.8-7.2, tightly buffered

    • Buffer Systems: 50 mM phosphate or MOPS buffer

    • Monitoring: Regular pH measurements as metabolic shifts from plsY expression may affect acid production

  • Growth Monitoring Protocol:

ParameterMethodFrequencyNormal Range
Cell densityOD660 measurementsEvery 6-12 hours0.1-2.0 OD660
pHpH electrodeDaily6.8-7.2
Plasmid retentionAntibiotic resistance platingAt inoculation and harvest>90% resistant colonies
Protein expressionWestern blot/activity assayMid and late exponential phaseStrain-dependent
Phospholipid profilesThin-layer chromatographyMid exponential and stationary phaseStrain-dependent

By systematically optimizing these parameters and documenting their effects on growth kinetics and plsY expression, researchers can establish reproducible cultivation protocols specific to their recombinant R. palustris strains.

What approaches can resolve contradictory results in plsY enzyme activity assays?

When faced with contradictory results in plsY enzyme activity assays, a systematic troubleshooting approach is essential:

  • Standardize Enzyme Preparation:

    • Issue: Variations in membrane fraction preparation can significantly affect enzyme activity

    • Resolution: Implement strict protocols for cell disruption, membrane isolation, and solubilization

    • Validation: Include internal standards or control enzymes with known activity in each preparation

  • Substrate Quality Assessment:

    • Issue: Degraded or oxidized substrates (glycerol-3-phosphate or acyl donors) can yield inconsistent results

    • Resolution: Prepare fresh substrates for each assay; store under inert gas; include antioxidants

    • Verification: Test commercial substrate quality using LC-MS before experiments

  • Reaction Conditions Optimization:

    • Issue: PlsY activity is highly sensitive to pH, temperature, and ionic strength

    • Resolution: Conduct systematic matrix experiments varying these parameters

    • Analysis: Generate heat maps of enzyme activity across different conditions to identify optimal ranges and potential interactions between parameters

  • Detection Method Validation:

    • Issue: Different product detection methods may yield conflicting results

    • Resolution: Compare multiple detection methods (radiochemical, colorimetric, MS-based)

    • Strategy: Use isotope-labeled substrates with LC-MS/MS detection for highest sensitivity and specificity

  • Statistical Approach to Contradictory Data:

    • Analysis Method: Apply mixed-effects models that account for batch effects

    • Experimental Design: Implement factorial designs to identify interaction effects

    • Data Handling: Use robust statistical methods resistant to outliers

  • Enzyme Kinetics Reconciliation:
    If different experimental setups yield different kinetic parameters:

    ParameterMethod 1Method 2Reconciliation Approach
    Km for G3PValue 1 ± SDValue 2 ± SDAnalyze substrate concentration ranges; verify linearity of Lineweaver-Burk plots
    VmaxValue 1 ± SDValue 2 ± SDStandardize enzyme quantification; correct for membrane protein content
    Substrate preferenceRanking ARanking BUse competition assays with multiple substrates simultaneously
    Inhibition profileProfile AProfile BTest inhibitors at multiple concentrations; determine Ki values

By systematically addressing these potential sources of variability and implementing appropriate controls, researchers can resolve contradictory results and establish reliable protocols for plsY enzyme activity determination.

How might directed evolution approaches be applied to engineer recombinant plsY with enhanced properties?

Directed evolution represents a powerful approach for engineering recombinant plsY with enhanced properties such as altered substrate specificity, increased stability, or modified regulatory characteristics:

  • Library Generation Strategies:

    • Error-prone PCR: Introduce random mutations throughout the plsY gene using manganese or unbalanced nucleotide concentrations

    • DNA Shuffling: Recombine multiple plsY homologs from different species to create chimeric enzymes

    • Site-saturation Mutagenesis: Systematically replace residues in the active site or substrate binding regions with all possible amino acids

    • Synthetic Library Design: Use computational approaches to design focused libraries targeting specific protein regions

  • Selection/Screening Systems:

    • Growth-based Selection: Engineer R. palustris strains where growth depends on plsY activity

    • Reporter Systems: Couple plsY activity to fluorescent protein expression through metabolic or genetic circuits

    • High-throughput Enzymatic Assays: Develop miniaturized assays compatible with automation

    • Biosensor Development: Create sensors that respond to lysophosphatidic acid production

  • Anticipated Improvements:

    Desired PropertySelection StrategySuccess Metrics
    Increased catalytic efficiencyGrowth rate in minimal media>2-fold increase in kcat/Km
    Altered substrate specificityComplementation in specialized mediaActivity with non-native substrates
    ThermostabilityHeat challenge before activity assayRetention of >50% activity after 50°C incubation
    pH toleranceActivity screening at extreme pH>30% activity at pH 5.5 or pH 9.0
    Reduced product inhibitionHigh substrate concentration challengeMaintained linearity at high substrate levels
  • Iteration and Validation:

    • Multiple rounds of selection with increasing stringency

    • Detailed biochemical characterization of improved variants

    • Structural analysis to understand the molecular basis of improvements

    • In vivo validation in various growth conditions

This directed evolution approach has potential applications in metabolic engineering of R. palustris for enhanced lipid production, creation of strains with novel membrane properties, and fundamental understanding of structure-function relationships in phospholipid biosynthesis enzymes.

What are the most promising applications of engineered R. palustris strains expressing recombinant plsY?

Engineered R. palustris strains expressing recombinant plsY offer several promising research and biotechnological applications:

  • Advanced Biofuel Production:

    • Mechanism: Modifying phospholipid synthesis pathways can divert carbon flux toward fatty acid production

    • Approach: Coupling plsY variants with thioesterases and fatty acid modification enzymes

    • Potential Impact: Development of photosynthetic microbial cell factories for sustainable biofuel production

  • Designer Membrane Engineering:

    • Concept: Creating R. palustris strains with customized membrane compositions

    • Applications: Enhanced tolerance to solvents, acids, or other industrial stressors

    • Research Value: Model systems for studying membrane adaptation and homeostasis

  • Biosynthesis of Specialty Lipids:

    • Target Compounds: Uncommon phospholipids, lysophospholipids, or lipid signaling molecules

    • Strategy: Expression of engineered plsY with altered substrate specificity

    • Markets: Pharmaceutical precursors, cosmetic ingredients, research biochemicals

  • Environmental Biotechnology:

    • Application: Enhanced bioremediation strains with modified membrane properties

    • Mechanism: Improved tolerance to pollutants and xenobiotics

    • Advantage: R. palustris naturally metabolizes aromatic compounds, and enhanced membrane properties could extend this capability

  • Fundamental Research Applications:

    • Membrane Biology: Models for studying phospholipid biosynthesis regulation

    • Bacterial Physiology: Understanding the role of membrane composition in stress responses

    • Evolutionary Biology: Investigating the adaptive significance of membrane lipid composition

  • Potential Commercial Applications:

    Application AreaEngineered PropertyMarket PotentialTechnical Challenges
    Biofuel productionEnhanced fatty acid synthesisHighBalancing cell growth with product formation
    Specialty biochemicalsNovel phospholipid productionMediumProduct extraction and purification
    BioremediationXenobiotic toleranceMedium-HighEnsuring genetic stability in field applications
    Research toolsReporter systems for lipid metabolismLow-MediumStandardization and reproducibility
    Synthetic biology platformsOrthogonal membrane systemsEmergingLong-term genetic stability

These applications leverage the metabolic versatility of R. palustris combined with the central role of plsY in phospholipid biosynthesis, creating opportunities for both fundamental research advances and practical biotechnological applications.

How can systems biology approaches enhance our understanding of plsY's role in R. palustris metabolism?

Systems biology approaches provide powerful frameworks for comprehensively understanding plsY's role in R. palustris metabolism:

  • Genome-Scale Metabolic Modeling:

    • Approach: Incorporate plsY and phospholipid biosynthesis pathways into constraint-based models of R. palustris metabolism

    • Methods: Flux Balance Analysis (FBA), Flux Variability Analysis (FVA), and Minimization of Metabolic Adjustment (MOMA)

    • Insights: Predict metabolic flux redistributions when plsY activity is altered, identify potential bottlenecks, and suggest complementary genetic modifications

  • Regulatory Network Reconstruction:

    • Goal: Map the transcriptional and post-translational regulation of plsY

    • Techniques: ChIP-seq for identifying transcription factor binding, ribosome profiling for translation efficiency, and phosphoproteomics for post-translational modifications

    • Outcomes: Comprehensive understanding of how plsY expression responds to environmental and metabolic cues

  • Multi-Scale Modeling Framework:

    • Components:

      • Molecular dynamics simulations of plsY structure and substrate interactions

      • Kinetic modeling of the phospholipid biosynthesis pathway

      • Cell-scale models of membrane composition and properties

      • Population-level models of adaptation and evolution

    • Integration: Multi-scale models connecting molecular events to cellular phenotypes

  • Experimental Systems Biology:

    • Perturbation Analysis: Systematic genetic modifications (overexpression, knockdown, point mutations) of plsY and related genes

    • Environmental Perturbations: Varied growth conditions (carbon sources, light intensity, stress conditions)

    • High-dimensional Data Collection: Transcriptomics, proteomics, metabolomics, lipidomics

  • Data Integration and Visualization:

    Data TypeIntegration MethodVisualization ApproachExpected Insights
    TranscriptomeCo-expression networksHeatmaps, network graphsCo-regulated gene modules
    ProteomeProtein-protein interaction networksInteraction mapsFunctional complexes and signaling
    MetabolomePathway enrichment analysisPathway maps with flux overlaysMetabolic bottlenecks and rerouting
    LipidomeCorrelation analysis with membrane propertiesComposition-property relationshipsFunctional consequences of lipid changes
    PhenomeMachine learning modelsDecision trees, principal component plotsPredictive models of phenotypic outcomes
  • Translation to Synthetic Biology Applications:

    • Using systems-level understanding to design minimal sets of genetic modifications

    • Predicting emergent properties of engineered strains

    • Designing robust control systems for regulated expression

By applying these systems biology approaches, researchers can move beyond reductionist views of plsY function to understand its role within the complex, interconnected metabolic and regulatory networks of R. palustris, enabling more effective and predictable metabolic engineering strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.