Recombinant Rhodopseudomonas palustris NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Metabolism

nuoK1 is part of the 14-subunit proton-translocating NADH:quinone oxidoreductase complex (Complex I), which is widespread in bacteria . In Rhodopseudomonas palustris, this complex contributes to:

  • Electron Transport: Facilitates the transfer of electrons from NADH to quinones, generating a proton motive force (PMF) across the cytoplasmic membrane .

  • Metabolic Versatility: Supports phototrophic and chemoheterotrophic lifestyles by interconverting redox energy and PMF, particularly under anaerobic conditions .

In phototrophic bacteria like Rhodopseudomonas, Complex I may reverse its activity to synthesize NADH from quinol using PMF, preventing overreduction of the quinone pool and supporting carbon fixation .

Genetic and Strain Diversity

Genomic analyses of R. palustris strains (e.g., CGA009, BisA53) reveal strain-specific variations in metabolic pathways, including differences in light-harvesting systems and biodegradation capabilities . Such diversity may influence the functional context of nuoK1 in different isolates.

Biochemical Studies

Recombinant nuoK1 has been used to study:

  • Protein Interactions: NMR spectroscopy has mapped interactions between periplasmic proteins (e.g., PioC) and light-harvesting complexes, though direct studies on nuoK1 remain pending .

  • Enzymatic Activity: The His-tagged construct enables purification for in vitro assays to assess NADH-quinone reductase activity and subunit assembly .

Applications in Biotechnology and Environmental Science

While direct applications of nuoK1 are not explicitly documented, its role in Complex I underscores potential uses in:

  • Bioenergetic Studies: Investigating bacterial respiration, PMF generation, and electron transport mechanisms.

  • Metabolic Engineering: Enhancing biofuel production or CO₂ fixation in engineered R. palustris strains .

Handling and Stability

Critical handling guidelines include:

ParameterRecommendation
Storage-20°C/-80°C (lyophilized), avoid repeated freeze-thaw cycles
ReconstitutionDeionized water (0.1–1.0 mg/mL) + 5–50% glycerol (for stability)
Working AliquotsStore at 4°C for ≤1 week; discard if precipitation or degradation occurs

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK1; RPA2940; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Target Names
nuoK1
Target Protein Sequence
MNEIGLGHFLSVAAVLFTLGTLGIFLNRKNVIIILMSIELMLLAVNINLVAFSIYLNDIV GQVFALLVLTVAAAEAAIGLAVLVVFFRNRGTIAVQDINLMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy within a proton gradient.
Database Links

KEGG: rpa:RPA2940

STRING: 258594.RPA2940

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhodopseudomonas palustris and why is it significant in research?

Rhodopseudomonas palustris is a rod-shaped, Gram-negative purple nonsulfur bacterium notable for its remarkable metabolic versatility. This organism can grow using all four major modes of metabolism: photoautotrophic, photoheterotrophic, chemoautotrophic, and chemoheterotrophic pathways. It is found extensively in nature, having been isolated from diverse environments including swine waste lagoons, earthworm droppings, marine coastal sediments, and pond water . The organism's metabolic flexibility makes it an excellent model for studying energy metabolism and has raised significant interest in the research community for potential biotechnological applications .

R. palustris appears as slimy masses that range from pale brown to peach-colored. Etymologically, its name derives from Greek and Latin roots: "rhodum" (rose), "pseudes" (false), "monas" (unit), and "palustris" (marshy), referencing both its appearance and common habitat .

What is NADH-quinone oxidoreductase and what role does the nuoK1 subunit play?

NADH-quinone oxidoreductase (Complex I) is a critical enzyme in the electron transport chain responsible for transferring electrons from NADH to quinones and simultaneously pumping protons across the membrane. In R. palustris, this complex contributes to the organism's ability to generate energy through various metabolic pathways.

The nuoK1 subunit is one of the membrane-embedded components of this complex, typically containing three transmembrane helices that help form the proton translocation pathway. While not directly involved in the catalytic activity of NADH oxidation, nuoK1 plays a crucial structural role in maintaining the integrity of the proton channel, contributing to the proton-pumping efficiency of the complex.

In the complete genome of R. palustris CGA009 (sequenced in 2004), genes coding for components of the electron transport chain, including NADH-quinone oxidoreductase, were identified . This strain contains 4,920 protein-coding genes distributed across its 5,459,214 base pair circular chromosome .

What genomic characteristics define R. palustris strains and how does this affect nuoK1 research?

Recent genomic analyses have revealed significant diversity among Rhodopseudomonas strains. When comparing average nucleotide identity (ANI) between various Rhodopseudomonas genomes, researchers found that many strains previously classified as R. palustris actually exhibit ANI values below the 95% species cutoff . For example, only strains 2.1.6 and B5 appear to be true R. palustris species based on nucleotide comparison .

This genomic diversity has important implications for nuoK1 research, as sequence variations between strains might result in functional differences in the NADH-quinone oxidoreductase complex. Researchers must therefore clearly specify which R. palustris strain they are working with and exercise caution when extrapolating findings between strains.

What are the optimal expression systems for recombinant nuoK1 production?

When expressing membrane proteins like nuoK1, several expression systems can be considered, each with distinct advantages:

Expression SystemAdvantagesDisadvantagesYield Potential
E. coli BL21(DE3)Fast growth, simple media, well-established protocolsMay form inclusion bodies, lacks post-translational modificationsMedium (1-3 mg/L)
E. coli C41/C43Designed for membrane proteins, reduced toxicityLower expression levels than BL21Low-Medium (0.5-2 mg/L)
Insect cellsBetter folding, some post-translational modificationsMore expensive, slower growthMedium (1-5 mg/L)
R. palustris itselfNative environment, proper foldingSlower growth, less established protocolsLow (0.1-1 mg/L)

For nuoK1 expression, a bacterial system using E. coli C41(DE3) or C43(DE3) strains is often recommended as the first approach, as these strains are engineered specifically for membrane protein expression. The protein should be tagged with a purification tag (His6 or Strep-tag) at either the N- or C-terminus, with a TEV protease cleavage site for tag removal if necessary.

Induction conditions typically involve lower temperatures (18-25°C) and reduced IPTG concentrations (0.1-0.5 mM) to promote proper folding rather than high expression levels.

What are the most effective purification strategies for recombinant nuoK1?

Purification of membrane proteins like nuoK1 requires specialized approaches:

  • Membrane Isolation: Following cell lysis, membranes are typically isolated through differential centrifugation.

  • Detergent Solubilization: Membrane proteins must be extracted using detergents. For nuoK1, mild detergents like n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations of 1-2% are recommended for initial solubilization, followed by reduced concentrations (0.05-0.1%) during purification.

  • Affinity Chromatography: For His-tagged nuoK1, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the primary purification step. Wash buffers typically contain 20-40 mM imidazole to reduce non-specific binding, with elution at 250-300 mM imidazole.

  • Size Exclusion Chromatography: This final purification step separates the protein based on size and ensures removal of aggregates. A Superdex 200 column is typically suitable for nuoK1 purification.

Temperature control (4°C) and the inclusion of protease inhibitors throughout the purification process are essential to maintain protein integrity.

How can researchers verify the proper folding and activity of recombinant nuoK1?

Several complementary approaches can assess the quality of purified recombinant nuoK1:

  • Circular Dichroism (CD) Spectroscopy: This technique can confirm the secondary structure content, particularly useful for verifying the presence of the expected alpha-helical transmembrane domains of nuoK1.

  • Thermal Shift Assays: These can evaluate the protein's stability in different buffer conditions and detergents.

  • Blue Native PAGE: This technique can assess whether nuoK1 is properly incorporated into the larger NADH-quinone oxidoreductase complex or subcomplexes.

  • Functional Reconstitution: Incorporation of purified nuoK1 into liposomes or nanodiscs followed by proton pumping assays can confirm functional integrity.

  • Complex I Activity Assays: While nuoK1 alone doesn't have catalytic activity, its incorporation into the full complex can be assessed through NADH oxidation assays coupled with artificial electron acceptors like ferricyanide.

What techniques are most effective for structural characterization of nuoK1?

Structural analysis of membrane proteins like nuoK1 presents significant challenges that require specialized approaches:

  • X-ray Crystallography: This remains challenging for membrane proteins but can provide high-resolution structures. For nuoK1, crystallization typically requires:

    • Protein concentrations of 10-15 mg/mL

    • Screening of detergent/lipid mixtures

    • Addition of lipid cubic phase for in meso crystallization

    • Antibody fragments to increase polar surface area

  • Cryo-electron Microscopy: This has become the method of choice for large membrane protein complexes like NADH-quinone oxidoreductase. For nuoK1 studies, the entire complex is typically purified and analyzed.

  • NMR Spectroscopy: While challenging for membrane proteins, solid-state NMR can provide valuable information about protein dynamics and specific residue interactions, particularly for smaller subunits like nuoK1.

  • Molecular Dynamics Simulations: These computational approaches can model nuoK1 behavior within a lipid bilayer and predict interactions with other subunits, complementing experimental structural studies.

The genomic analysis of R. palustris strains suggests that researchers should consider potential structural variations between different strains when interpreting structural data .

How does nuoK1 contribute to the metabolic versatility of R. palustris?

R. palustris is remarkable for its ability to switch between four different metabolic modes: photoautotrophic, photoheterotrophic, chemoautotrophic, and chemoheterotrophic . The NADH-quinone oxidoreductase complex, including the nuoK1 subunit, plays different roles depending on the metabolic mode:

  • In Chemoheterotrophic Growth: Complex I oxidizes NADH produced during carbon source oxidation, feeding electrons into the respiratory chain.

  • In Chemoautotrophic Growth: The complex may operate in reverse, using the proton gradient to drive NAD+ reduction for CO2 fixation.

  • In Photoheterotrophic Growth: The role of Complex I may be diminished as cyclic electron flow through the photosystem can generate the proton gradient.

  • In Photoautotrophic Growth: Similar to chemoautotrophic growth, the complex may participate in generating reducing power for carbon fixation.

Research approaches to study these different roles include:

  • Comparative growth experiments with nuoK1 mutants under different metabolic conditions

  • Transcriptomic analysis to measure nuoK1 expression levels across growth conditions

  • Isotope labeling to track electron flow in different metabolic modes

What are the best approaches for studying nuoK1 protein-protein interactions?

Understanding how nuoK1 interacts with other subunits of the NADH-quinone oxidoreductase complex is crucial for elucidating its function. Several complementary techniques can be employed:

  • Crosslinking Mass Spectrometry: Chemical crosslinkers that react with specific amino acid residues can capture interactions between nuoK1 and neighboring subunits. After digestion, crosslinked peptides are identified by mass spectrometry, revealing proximities between protein regions.

  • FRET Analysis: By creating fusion proteins with fluorescent proteins at the termini of nuoK1 and potential interaction partners, Förster Resonance Energy Transfer can detect close associations in living cells.

  • Co-immunoprecipitation: Using antibodies against nuoK1 or an epitope tag to pull down the protein along with its interaction partners.

  • Bacterial Two-Hybrid Systems: Modified for membrane proteins, these genetic systems can screen for potential interaction partners in vivo.

  • Nanodiscs or Liposome Reconstitution: By reconstituting defined combinations of purified subunits, researchers can systematically test which subunits directly interact with nuoK1 and how these interactions affect function.

Data from these studies can be integrated with structural information to create detailed interaction maps of the NADH-quinone oxidoreductase complex in R. palustris.

What strategies are effective for creating nuoK1 mutations in R. palustris?

Creating precise mutations in the nuoK1 gene of R. palustris requires consideration of the organism's genetic characteristics:

  • Homologous Recombination: Traditional approach using suicide vectors containing the mutated gene flanked by homologous regions. The pK18mobsacB system has been successful in R. palustris, allowing for marker-free mutations through two-step selection.

  • CRISPR-Cas9 Systems: Newer approaches adapted for R. palustris can achieve higher efficiency. The system typically uses:

    • A plasmid expressing Cas9 optimized for R. palustris codon usage

    • A guide RNA targeting the nuoK1 sequence

    • A repair template containing the desired mutation with ~1 kb homology arms

  • Site-Directed Mutagenesis Targets: Key residues for mutagenesis in nuoK1 typically include:

    • Conserved charged residues in the transmembrane helices

    • Residues facing the predicted proton channel

    • Residues at interfaces with other subunits

The complete genome sequence of R. palustris CGA009 provides the necessary reference for designing precise genetic manipulations .

How can researchers assess the phenotypic effects of nuoK1 mutations?

After creating nuoK1 mutations, comprehensive phenotypic characterization is essential:

  • Growth Analysis: Comparing growth rates of wild-type and mutant strains under different metabolic conditions:

    • Aerobic heterotrophic growth (rich and minimal media)

    • Anaerobic photoheterotrophic growth

    • Photoautotrophic growth

    • Chemoautotrophic growth with hydrogen

  • Bioenergetic Parameters Measurement:

    • Membrane potential using fluorescent dyes like DiSC3(5)

    • NADH/NAD+ ratio using enzymatic assays

    • ATP production rates

    • Oxygen consumption or hydrogen production rates

  • Complex I Activity Assays:

    • NADH:ubiquinone oxidoreductase activity in membrane preparations

    • Proton pumping efficiency in reconstituted systems

  • Omics Approaches:

    • Transcriptomics to identify compensatory changes in gene expression

    • Metabolomics to detect alterations in metabolic pathways

    • Proteomics to assess effects on complex assembly

These approaches collectively provide a comprehensive understanding of how specific residues in nuoK1 contribute to the function of the NADH-quinone oxidoreductase complex in the context of R. palustris' metabolic versatility.

What considerations are important when comparing nuoK1 between different R. palustris strains?

Recent genome analyses have revealed significant genetic diversity among strains classified as R. palustris. When comparing nuoK1 between strains, researchers should consider:

  • Sequence Divergence: Average nucleotide identity (ANI) analyses show that many R. palustris strains exhibit less than 95% identity, suggesting they may represent different species . For example, strains R1, CG009, TIE, and ELI1980 appear to be more closely related to each other (>97% ANI) than to other R. palustris strains .

  • Methodology for Comparison:

    • Multiple sequence alignment of nuoK1 sequences from different strains

    • Phylogenetic analysis to determine evolutionary relationships

    • Structural modeling to predict functional differences

    • Experimental validation through cross-complementation studies

  • Data Interpretation Cautions:

    • Phenotypic differences between strains may be due to factors beyond nuoK1 variations

    • The genomic context of nuoK1 may differ between strains, affecting expression and regulation

    • Environmental adaptations may have selected for specific nuoK1 variants optimized for different niches

This genomic diversity necessitates careful strain selection for research and transparent reporting of the specific strain used in all publications.

How can nuoK1 research contribute to understanding redox metabolism in R. palustris?

Research on nuoK1 can provide valuable insights into the broader redox metabolism of R. palustris:

The metabolic versatility of R. palustris makes it an excellent model for studying the flexibility of electron transport chains in response to environmental conditions .

What are the potential biotechnological applications of engineered nuoK1 variants?

Modified versions of nuoK1 could contribute to several biotechnological applications:

  • Biohydrogen Production: Engineered nuoK1 variants might enhance electron flux toward hydrogenase enzymes, potentially increasing hydrogen production rates. This application leverages R. palustris' natural capacity for hydrogen production during nitrogen fixation.

  • Bioremediation: Optimized electron transport chains could improve the degradation of recalcitrant aromatic compounds in contaminated environments.

  • Bioenergy Applications: Enhanced respiratory chains could improve biomass production for bioenergy applications, particularly in photobioreactors utilizing R. palustris.

  • Biosensors: Engineered strains with modified nuoK1 could serve as whole-cell biosensors for specific environmental conditions, based on changes in energy metabolism.

  • Synthetic Biology Platforms: R. palustris with engineered electron transport chains could serve as platforms for synthetic biology applications requiring fine control over redox balance.

For these applications, the complete genome sequence of R. palustris and understanding of its metabolic versatility provide essential foundational knowledge .

How can single-cell approaches advance our understanding of nuoK1 function?

Traditional bulk analyses may mask cell-to-cell heterogeneity in nuoK1 expression and function. Advanced single-cell approaches offer new research opportunities:

  • Single-Cell Transcriptomics: This can reveal whether nuoK1 expression varies between individual cells in a population, potentially identifying subpopulations with distinct metabolic states.

  • Single-Cell Protein Localization: Using fluorescent protein fusions to track the localization and abundance of nuoK1 in individual cells across different growth conditions.

  • Single-Cell Bioenergetics: Techniques such as:

    • Fluorescence lifetime imaging of NAD(P)H to measure redox state

    • Membrane potential-sensitive dyes to assess proton motive force

    • ATP biosensors to measure energy status

  • Microfluidic Approaches: These allow precise control of the microenvironment around individual cells, enabling:

    • Rapid media switches to study metabolic mode transitions

    • Long-term tracking of individual cells across generations

    • Creation of defined environmental gradients

  • N-of-1 Experimental Design: Single-cell approaches align with N-of-1 trial concepts, where repeated measurements on individual cells can provide statistically robust data even with cellular heterogeneity .

These approaches can uncover previously hidden aspects of nuoK1 function and regulation, particularly in the context of R. palustris' remarkable metabolic flexibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.