Recombinant Rhodopseudomonas palustris NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK2; RPA4255; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Target Names
nuoK2
Target Protein Sequence
MTGSDLIGIMILAAGLFAVGVFGVLARRGMLFQLVALEVALSGPALGFIAAGAYHADPEG QGMFILVLTLAAAEVAVGLALFLRLRRLTGTDDSDAISGLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is considered the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy as a proton gradient.
Database Links

KEGG: rpa:RPA4255

STRING: 258594.RPA4255

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K 2 in Rhodopseudomonas palustris?

NADH-quinone oxidoreductase subunit K 2 (nuoK2) is an integral membrane protein component of Complex I in the respiratory chain of Rhodopseudomonas palustris. This protein plays a crucial role in energy transduction by participating in electron transfer from NADH to quinone and contributing to proton translocation across the membrane. In R. palustris, nuoK2 is part of the sophisticated bioenergetic machinery that enables this purple non-sulfur bacterium to thrive in diverse environmental conditions using various metabolic pathways. The recombinant form of this protein typically includes affinity tags such as His-tags to facilitate purification and subsequent analysis .

How does nuoK2 differ structurally and functionally between R. palustris strains?

Structural and functional variations in nuoK2 exist across different R. palustris strains, reflecting evolutionary adaptations to specific environmental niches. For example, comparative genomic analyses between strains like CGA009 and RCB100 have revealed significant genetic differences that affect their metabolic capabilities . While specific nuoK2 variations haven't been comprehensively documented across all strains, the adaptive capabilities of R. palustris suggest strain-specific modifications in respiratory chain components, potentially including nuoK2. These variations may manifest as amino acid substitutions that affect proton channeling efficiency, quinone binding, or interactions with adjacent subunits. Researchers should consider these potential strain-specific differences when studying nuoK2 function or using recombinant expressions from different source strains.

What techniques are available for preliminary characterization of nuoK2?

Several techniques are suitable for preliminary characterization of nuoK2:

  • Sequence analysis: Alignment with homologous proteins using tools like BLAST and Clustal Omega to identify conserved domains and functional motifs.

  • Hydropathy plotting: Analysis of transmembrane domains using prediction algorithms like TMHMM or Phobius.

  • Western blotting: Detection of recombinant nuoK2 using antibodies against the protein or affinity tags.

  • Mass spectrometry: Verification of protein identity and post-translational modifications.

  • Circular dichroism: Assessment of secondary structure components.

For optimal results, researchers should use a combination of these techniques rather than relying on a single method. Particular attention should be paid to maintaining the integrity of membrane proteins during sample preparation, potentially using mild detergents like n-dodecyl-β-D-maltoside to maintain native-like conformations .

What expression systems are optimal for producing recombinant R. palustris nuoK2?

The optimal expression system for recombinant R. palustris nuoK2 depends on research objectives, but several systems have proven effective:

Escherichia coli expression systems:

  • BL21(DE3) strains are commonly used for membrane protein expression, particularly when coupled with specialized vectors.

  • C41(DE3) and C43(DE3) strains, derived from BL21(DE3), are engineered specifically for toxic membrane protein expression.

  • Expression in E. coli provides advantages of rapid growth, high protein yields, and established protocols .

Homologous expression in R. palustris:

  • Expression within R. palustris itself ensures appropriate membrane insertion and folding.

  • Methods for genetic manipulation of R. palustris include plasmid transformation via electroporation and homologous recombination for genomic integration.

  • Selective markers for R. palustris include resistance to gentamicin (300 μg/ml), kanamycin (200-300 μg/ml), and spectinomycin (300 μg/ml) .

For expression in R. palustris, researchers should culture cells in PM media supplemented with appropriate carbon sources (such as 20 mM sodium acetate) and maintain temperatures around 30°C for optimal growth conditions .

What purification strategies yield the highest purity of recombinant nuoK2?

Purification of recombinant nuoK2 requires specialized approaches due to its hydrophobic nature as a membrane protein:

Membrane extraction and solubilization:

  • Isolate cell membranes through differential centrifugation

  • Solubilize membranes using detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin

  • Optimize detergent concentration to balance protein solubilization and stability

Affinity chromatography:

  • For His-tagged nuoK2, use immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins

  • Implement step gradients of imidazole (20-250 mM) for selective elution

  • Add detergent to all buffers to prevent protein aggregation

Size exclusion chromatography (SEC):

  • Use as a polishing step to separate aggregates and contaminants

  • Select appropriate column matrix (Superdex 200 or Superose 6) based on molecular weight

  • Analyze SEC profiles to assess protein homogeneity

Purity assessment:

  • SDS-PAGE with Coomassie staining (target >90% purity)

  • Western blotting using anti-His antibodies

  • Mass spectrometry for molecular weight confirmation

For optimal results, all purification steps should be conducted at 4°C to minimize protein degradation, and purification buffers should contain stabilizing agents like glycerol (10%) and reducing agents like DTT or TCEP .

How can researchers validate the structural integrity of purified recombinant nuoK2?

Validating the structural integrity of purified recombinant nuoK2 is critical before functional studies. Multiple complementary approaches should be employed:

Biophysical characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Thermal shift assays to evaluate protein stability

  • Dynamic light scattering (DLS) to determine size distribution and aggregation state

Functional validation:

  • NADH:ubiquinone oxidoreductase activity assays

  • Proton translocation measurements using pH-sensitive fluorescent dyes

  • Binding assays with known interaction partners

Structural analysis:

  • Limited proteolysis to probe accessibility of cleavage sites

  • Negative-stain electron microscopy to visualize protein particles

  • Cryo-electron microscopy for higher-resolution structural assessment

Quality control metrics table:

Validation MethodExpected ResultTroubleshooting
CD SpectroscopyHigh α-helical contentAdjust detergent composition
SEC-MALSMonodisperse peakOptimize buffer conditions
NADH:Q activity>70% of native proteinVerify quinone accessibility
Thermal stabilityTm > 40°CAdd stabilizing agents
Protease resistanceLimited accessible sitesRefine purification protocol

Researchers should develop a validation pipeline that incorporates multiple methods, as reliance on a single technique may provide an incomplete assessment of protein integrity .

What assays can accurately measure the activity of recombinant nuoK2 within the Complex I context?

Measuring the activity of recombinant nuoK2 within Complex I presents challenges due to its role as part of a multisubunit enzyme complex. Several complementary approaches are recommended:

Enzymatic activity assays:

  • NADH:ubiquinone oxidoreductase activity using spectrophotometric monitoring of NADH oxidation at 340 nm

  • Artificial electron acceptors like ferricyanide can assess partial reactions

  • Oxygen consumption measurements using Clark-type electrodes when coupled to terminal oxidases

Proton pumping assays:

  • pH-sensitive fluorescent probes (ACMA, pyranine) to monitor proton translocation

  • Reconstitution into liposomes for directional proton pumping assessment

  • Potassium/valinomycin systems to generate membrane potentials

Binding studies:

  • Isothermal titration calorimetry (ITC) to quantify quinone binding

  • Surface plasmon resonance (SPR) to assess interactions with other subunits

  • Fluorescence quenching studies with labeled quinone analogs

Structural determination during function:

  • EPR spectroscopy to monitor iron-sulfur cluster redox states

  • FRET-based approaches to monitor conformational changes during catalysis

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

For nuoK2-specific studies, researchers can develop complementation systems in which native nuoK2 is deleted from R. palustris and replaced with variants, similar to the homologous recombination approaches developed for R. palustris genome engineering .

How can researchers distinguish between the roles of different subunits when studying Complex I function?

Distinguishing the specific roles of nuoK2 from other Complex I subunits requires targeted experimental approaches:

Genetic approaches:

  • Gene deletion and complementation studies using homologous recombination techniques

  • Site-directed mutagenesis of conserved residues specific to nuoK2

  • Domain swapping with homologous subunits from other organisms

The suicide plasmid methodology described for R. palustris can be adapted for nuoK2 modifications, utilizing suicide vectors containing homology arms flanking the nuoK2 gene, antibiotic selection markers, and counterselection systems like sacB for sucrose sensitivity .

Biochemical approaches:

  • Crosslinking studies to identify interaction partners

  • Partial complex reconstitution with purified components

  • Inhibitor studies with subunit-specific compounds

Comparative analysis:

  • Evolutionary analysis across bacterial species

  • Comparison between multiple R. palustris strains with different metabolic capabilities

  • Comparing phenotypes across growth conditions that differentially rely on Complex I activity

Data integration from multi-omics:

  • Combining transcriptomics, proteomics, and metabolomics data

  • Flux balance analysis incorporating nuoK2 variants

  • Building computational models of electron transfer through Complex I

When designing these experiments, researchers should leverage the genetic tools developed for R. palustris, including the established protocols for suicide plasmid construction, homologous recombination, and antibiotic selection at appropriate concentrations (gentamicin at 300 μg/ml, kanamycin at 200-300 μg/ml) .

How do mutations in nuoK2 affect the assembly and stability of Complex I?

Mutations in nuoK2 can significantly impact Complex I assembly and stability through several mechanisms:

Effects on complex assembly:

  • Transmembrane domain disruptions can prevent proper membrane insertion

  • Interface mutations may disrupt interactions with adjacent subunits

  • Conserved residues likely play critical roles in subunit recognition during assembly

Experimental approaches to assess assembly defects:

  • Blue native PAGE to visualize intact complexes and subcomplexes

  • Pulse-chase experiments to monitor assembly kinetics

  • Co-immunoprecipitation to identify altered subunit interactions

  • Proteoliposome stability assays under varying conditions

Methodological considerations for mutation studies:

  • Use site-directed mutagenesis targeting conserved residues

  • Employ R. palustris genetic engineering approaches using suicide plasmids

  • Design complementation experiments with wild-type and mutant variants

  • Implement double homologous recombination techniques as described for R. palustris genome engineering

When conducting these studies in R. palustris, researchers should culture cells under appropriate growth conditions (30°C, PM media supplemented with carbon sources like sodium acetate) and select transformants using established antibiotic concentrations .

How should researchers approach contradictory results in nuoK2 functional studies?

When confronted with contradictory results in nuoK2 functional studies, researchers should implement a systematic troubleshooting approach:

Source validation:

  • Verify sequence identity of nuoK2 constructs through sequencing

  • Confirm strain identity to prevent cross-contamination

  • Validate antibody specificity through appropriate controls

Experimental conditions assessment:

  • Evaluate buffer composition effects (pH, ionic strength, detergents)

  • Test temperature sensitivity of assays

  • Consider oxygen exposure impacts on anaerobic proteins

Methodological triangulation:

  • Apply multiple orthogonal techniques to measure the same parameter

  • Use different expression systems to rule out host-specific effects

  • Compare results with published data on homologous proteins

Statistical robustness analysis:

  • Increase biological and technical replicates

  • Apply appropriate statistical tests for sample size

  • Consider Bayesian approaches for integrating prior knowledge

Data reconciliation strategies:

  • Identify parameters that explain apparent contradictions

  • Develop testable hypotheses to resolve discrepancies

  • Design critical experiments that distinguish between competing models

When analyzing conflicting results, researchers should consider that R. palustris strains can exhibit significant genetic and phenotypic differences, as demonstrated by comparative genomic analyses of strains like RCB100 and CGA009, which revealed large deletions and other mutations affecting their metabolic capabilities .

What statistical approaches are most appropriate for analyzing nuoK2 activity data?

The statistical analysis of nuoK2 activity data requires careful consideration of experimental design and data characteristics:

Descriptive statistics:

  • Central tendency measures (mean, median) for activity levels

  • Dispersion parameters (standard deviation, quartiles) to assess variability

  • Normality testing to determine appropriate inferential methods

Inferential statistics:

  • Parametric tests (t-test, ANOVA) for normally distributed data

  • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normal distributions

  • Post-hoc tests with appropriate corrections for multiple comparisons

Regression and correlation analyses:

  • Linear regression for activity-concentration relationships

  • Non-linear models for enzyme kinetics (Michaelis-Menten, Hill equations)

  • Correlation analyses to identify relationships between multiple parameters

Advanced statistical approaches:

  • Mixed-effects models to account for batch variations

  • Bootstrapping for robust confidence interval estimation

  • Bayesian inference for incorporating prior knowledge

Experimental design considerations:

  • Power analysis to determine sample size requirements

  • Randomization and blocking to control for confounding variables

  • Factorial designs to assess interaction effects between variables

The table below summarizes appropriate statistical tests for common experimental scenarios:

Experimental DesignData DistributionRecommended TestSample Size Requirement
Two conditionsNormalPaired t-test≥30 per group
Multiple conditionsNormalOne-way ANOVA with Tukey post-hoc≥20 per group
Two factorsNormalTwo-way ANOVA≥15 per condition
Non-normal dataAnyNon-parametric tests≥10 per group
Enzyme kineticsNon-linearNon-linear regression≥8 substrate concentrations

When analyzing complex datasets from techniques like mass spectrometry or spectroscopy, consider dimension reduction techniques such as principal component analysis (PCA) or partial least squares (PLS) regression.

How can computational modeling enhance understanding of nuoK2 function?

Computational modeling provides powerful approaches for understanding nuoK2 function beyond experimental limitations:

Structural modeling approaches:

  • Homology modeling using solved structures of bacterial Complex I

  • Molecular dynamics simulations to study conformational dynamics

  • Quantum mechanics/molecular mechanics (QM/MM) for electron transfer processes

Systems biology approaches:

  • Flux balance analysis incorporating nuoK2 function

  • Kinetic modeling of electron transport chain activities

  • Genome-scale metabolic models of R. palustris energy metabolism

Integration of experimental data:

  • Constraint-based modeling using spectroscopic data

  • Bayesian parameter estimation from kinetic measurements

  • Model refinement through iterative experimental validation

Practical implementation workflow:

  • Build initial models based on sequence homology

  • Refine models with experimental constraints

  • Validate predictions through targeted experiments

  • Iterate between computational predictions and experimental testing

Resources and tools:

  • AlphaFold2 or RoseTTAFold for structure prediction

  • GROMACS or NAMD for molecular dynamics simulations

  • COPASI for biochemical network modeling

  • COBRApy for genome-scale metabolic modeling

When applying these computational approaches to nuoK2, researchers should leverage genomic information from sequenced R. palustris strains and consider the genetic context of nuoK2 within the organism's respiratory pathways .

How can nuoK2 research contribute to understanding R. palustris metabolic versatility?

Research on nuoK2 provides significant insights into the remarkable metabolic versatility of R. palustris:

Bioenergetic flexibility:

  • nuoK2's role in energy conservation during different growth modes

  • Contribution to electron flow under aerobic versus anaerobic conditions

  • Involvement in balancing redox states during metabolic transitions

Environmental adaptation mechanisms:

  • Regulation of Complex I activity in response to environmental stressors

  • Contribution to survival under nutrient-limited conditions

  • Role in energy conservation during degradation of recalcitrant compounds

R. palustris demonstrates exceptional capabilities in aromatic compound degradation, and Complex I components like nuoK2 may contribute to energy conservation during metabolism of these substrates. Recent studies on R. palustris RCB100 have demonstrated its ability to degrade halogenated aromatic compounds like 3-chlorobenzoate, with energy conservation mechanisms likely involving respiratory chain components .

Biotechnological applications:

  • Engineering enhanced bioremediation capabilities

  • Optimizing bioenergy production pathways

  • Developing biosensors for environmental monitoring

Experimental approaches:

  • Comparative studies across growth conditions

  • Metabolic flux analysis with nuoK2 variants

  • Integration with "-omics" approaches to build comprehensive models

When designing experiments to investigate these questions, researchers should consider leveraging the genetic tools developed for R. palustris, including methods for gene deletion, complementation, and site-directed mutagenesis through homologous recombination .

What aspects of nuoK2 research remain unexplored or controversial?

Despite advances in understanding bacterial Complex I, several aspects of nuoK2 research remain unexplored or controversial:

Structural uncertainties:

  • Precise arrangement of transmembrane helices within the membrane domain

  • Conformational changes during catalytic cycle

  • Lipid-protein interactions that affect stability and function

Mechanistic questions:

  • Exact proton translocation pathway through nuoK2

  • Conformational coupling between electron transfer and proton pumping

  • Role in supercomplex formation with other respiratory enzymes

Evolutionary perspectives:

  • Origin and diversification of nuoK2 across bacterial lineages

  • Selective pressures driving nuoK2 sequence conservation

  • Co-evolution with other Complex I subunits

Regulatory aspects:

  • Transcriptional and post-translational regulation under varying conditions

  • Protein turnover and quality control mechanisms

  • Assembly factors specific for nuoK2 incorporation

Methodological challenges:

  • Development of nuoK2-specific inhibitors or activity probes

  • Techniques for in vivo activity measurement

  • High-resolution structural determination in native-like environments

Research exploring these questions should utilize the genomic and experimental tools available for R. palustris, including comparative genomic approaches between strains with different metabolic capabilities, such as the characterized differences between strains RCB100 and CGA009 .

How might advances in nuoK2 research impact broader fields in microbial bioenergetics?

Advances in nuoK2 research have potential to impact multiple areas in microbial bioenergetics and beyond:

Fundamental understanding of energy transduction:

  • Mechanisms of redox-driven proton pumping

  • Principles of energy conservation in biological systems

  • Structure-function relationships in membrane protein complexes

Applied microbiology:

  • Engineering bacteria with enhanced bioremediation capabilities

  • Developing microbial fuel cells with improved performance

  • Creating biosensors for environmental monitoring

R. palustris strains have demonstrated capabilities in degrading anthropogenic substances and restoring polluted environments, with their respiratory components including Complex I playing crucial roles in these processes .

Antimicrobial development:

  • Complex I as a target for selective inhibitors

  • Understanding antibiotic resistance mechanisms involving respiratory components

  • Nuance in targeting energy metabolism across bacterial species

Interestingly, genome analysis of Rhodopseudomonas strains has revealed the presence of antibiotic resistance genes, suggesting potential resistance mechanisms involving respiratory chain components .

Evolutionary microbiology:

  • Tracing the evolution of respiratory complexes across prokaryotes

  • Understanding adaptation to diverse ecological niches

  • Comparative genomics of energy conservation strategies

Methodological advances:

  • Novel approaches for membrane protein characterization

  • Improved techniques for functional reconstitution

  • Integration of computational and experimental methods

Research in this area should leverage the diverse metabolic capabilities of R. palustris strains and the growing toolkit for genetic manipulation in these bacteria, including homologous recombination approaches and selective markers optimized for R. palustris .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.