Recombinant Rhodopseudomonas palustris NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rhodopseudomonas palustris NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Rhodopseudomonas palustris NADH-quinone oxidoreductase subunit K (nuoK) is a transmembrane protein subunit of Complex I (proton-translocating NADH:quinone oxidoreductase), a key enzyme in bacterial respiratory chains. This enzyme catalyzes the oxidation of NADH and reduction of quinone while translocating protons across membranes, contributing to ATP synthesis . The recombinant form is produced heterologously, typically in E. coli, with modifications such as His-tagging for purification .

Gene Information

ParameterValue
Gene NamenuoK (R. palustris)
Uniprot IDQ13BG6 (strain ATCC BAA-98 / CGA009) ; Q6N5N4 (nuoK1 variant)
LocusPart of a polycistronic operon (nuoA to nuoN)
Expression HostE. coli

Recombinant Production and Handling

The protein is expressed in E. coli with a His-tag for affinity chromatography. Post-production handling requires careful storage to maintain stability:

  • Reconstitution: Deionized water (0.1–1.0 mg/mL) with optional glycerol (5–50% v/v) .

  • Stability: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

  • Buffer: Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

Functional Role in Complex I

Complex I in R. palustris serves dual roles:

  1. Electrochemical Energy Conversion: Drives NADH oxidation → quinol reduction while translocating protons, generating a proton motive force (PMF) .

  2. Redox Balance Regulation: Prevents overreduction of the quinone pool under phototrophic conditions, crucial for CO₂ fixation and nitrogenase activity .

Strain-Specific Insights

  • CGA009: Contains a complete nuo operon, enabling efficient NADH:quinone coupling .

  • BisA53: Metabolic models predict its role in H₂ production and aromatic compound degradation .

Biotechnological Potential

  • Bioenergy: Engineered Complex I variants may enhance biohydrogen production or microbial fuel cells .

  • Bioremediation: R. palustris strains with functional nuoK are explored for degrading aromatic pollutants .

Challenges and Future Directions

  • Homology Challenges: Subunit K in R. palustris shows limited homology to eukaryotic Complex I, complicating structural comparisons .

  • Operon Engineering: Synthetic biology approaches aim to optimize nuo operon expression for industrial applications .

Comparative Data Table: Recombinant nuoK Variants

ParameterQ13BG6 (nuoK) Q6N5N4 (nuoK1)
Strain SourceATCC BAA-98 / CGA009Strain ATCC BAA-98
AA SequenceMTGSDLIAMMILAAGLFAIGLFGVLARRGIMFQLVALEVALSGPALGFVAAGAYHADPQGQGMFILVLTLAAAEVAVGLALFLRIRRIAGSDDSDVISGMKGMNEIGLGHFLSVAAVLFTLGTLGIFLNRKNVIIILMSIELMLLAVNINLVAFSIYLNDIVGQVFALLVLTVAAAEAAIGLAVLVVFFRNRGTIAVQDINLMKG
ApplicationsStructural studies, bioenergetic assaysEnzyme kinetics, functional assays

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. This can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Rpal_4734; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain TIE-1)
Target Names
nuoK
Target Protein Sequence
MTGSDLIGIMILAAGLFAVGVFGVLARRGMLFQLVALEVALSGPALGFIAAGAYHADPEG QGMFILVLTLAAAEVAVGLALFLRLRRLTGTDDSDAISGLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction to proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase subunit K (nuoK) in Rhodopseudomonas palustris?

NADH-quinone oxidoreductase subunit K (nuoK) is an integral membrane protein component of the bacterial Complex I in R. palustris. This complex couples electron transfer from NADH to ubiquinone with proton translocation across the membrane, contributing to the proton motive force used for ATP synthesis.

Methodologically, researchers characterize this function through:

  • Gene knockout studies demonstrating altered growth characteristics under different conditions

  • Membrane protein isolation and reconstitution experiments

  • Electron transport chain activity assays measuring NADH oxidation rates

  • Comparative genomic analyses with related bacterial species

In R. palustris specifically, Complex I functions within a versatile metabolic network that allows this organism to switch between multiple growth modes (photosynthetic, heterotrophic, chemoautotrophic). Under anaerobic light conditions at 28°C, which are optimal for R. palustris cultivation, the electron transport chain configuration may differ significantly from standard respiratory conditions .

How do you express and purify recombinant nuoK from Rhodopseudomonas palustris?

Expression and purification of recombinant nuoK requires specialized approaches due to its hydrophobic nature as a membrane protein:

  • Vector construction:

    • Expression vector with appropriate promoter (T7 for E. coli systems)

    • Fusion tag (His6, MBP, or GST) for purification

    • Codon optimization for heterologous expression

  • Expression system options:

    • Homologous expression in R. palustris (advantages: proper folding; disadvantages: lower yield)

    • Heterologous expression in E. coli BL21(DE3) (advantages: higher yield; disadvantages: potential improper folding)

    • Cell-free protein synthesis systems for challenging membrane proteins

  • Expression conditions:

    • Lower temperatures (16-25°C) for improved membrane protein folding

    • IPTG concentration optimization (0.1-1.0 mM) for T7-based systems

    • Media supplements including specific lipids or membrane protein enhancers

  • Membrane protein extraction:

    • Cell disruption via sonication or French press

    • Membrane fraction isolation by ultracentrifugation

    • Detergent screening for optimal solubilization (DDM, LDAO, OG)

  • Purification protocol:

    • IMAC (immobilized metal affinity chromatography) for His-tagged proteins

    • Size exclusion chromatography as secondary purification

    • Buffer optimization containing appropriate detergents and lipids

When working with R. palustris proteins, cultivation conditions similar to those used for strain DSM 8283 may be necessary, which grows optimally under anaerobic conditions in light at 28°C .

How does the nuoK gene vary among different Rhodopseudomonas palustris strains?

Variation in the nuoK gene sequence across R. palustris strains provides insights into strain-specific metabolic adaptations. Methodological approaches include:

  • Comparative genomic analysis:

    • Multiple sequence alignment of nuoK sequences from different strains

    • Identification of strain-specific single nucleotide polymorphisms

    • Phylogenetic analysis in relation to whole-genome phylogeny

Different R. palustris strains exhibit varied metabolic capabilities, particularly related to plant growth promotion and nitrogen fixation. For example, strains PS3 and YSC3 have similar genomic structures but show significantly different effects on plant growth, with PS3 demonstrating enhanced nitrate uptake efficiency and stimulation of endogenous auxin in plants . Similarly, strains like NifA* and PB23 show different nitrogen fixation capacities .

  • Expression analysis across strains:

    • RT-qPCR to quantify nuoK expression under identical growth conditions

    • RNA-Seq for global transcriptional comparison

    • Proteomic analysis of protein abundance levels

  • Functional comparison:

    • Enzyme activity assays for NADH dehydrogenase across strains

    • Growth rate comparison under conditions requiring efficient electron transport

    • Respiratory vs. photosynthetic growth efficiency measurements

Understanding strain variations in nuoK may help explain the different capabilities observed between R. palustris strains in applications ranging from plant growth promotion to nitrogen fixation .

What are the structural characteristics of nuoK in Rhodopseudomonas palustris?

The nuoK subunit in R. palustris is a highly hydrophobic integral membrane protein with multiple transmembrane helices:

  • Predicted structural features:

    • 3-4 transmembrane α-helical domains spanning the cytoplasmic membrane

    • Approximately 100-120 amino acids in length

    • Conserved charged residues likely involved in proton translocation

  • Methodological approaches for structural characterization:

    • Homology modeling based on solved structures from related organisms

    • Secondary structure prediction algorithms (PSIPRED, JPred)

    • Transmembrane topology prediction (TMHMM, Phobius)

    • Hydrophobicity plot analysis using Kyte-Doolittle or similar scales

  • Experimental structural determination methods:

    • X-ray crystallography of purified Complex I or reconstituted membrane subunits

    • Cryo-electron microscopy for membrane protein complexes

    • Site-directed spin labeling coupled with EPR spectroscopy

    • Limited proteolysis combined with mass spectrometry

The structural arrangement of nuoK within the membrane domain of Complex I is critical for understanding its role in proton translocation and energy conservation, which may vary under different growth conditions such as the anaerobic light conditions typically used for R. palustris cultivation .

How does nuoK contribute to the energy metabolism in R. palustris under different growth conditions?

R. palustris exhibits remarkable metabolic versatility, capable of growing under multiple conditions. The nuoK subunit, as part of Complex I, likely plays different roles depending on the energy generation pathway:

  • Methodological approaches to investigate condition-dependent roles:

    • Growth experiments under defined metabolic conditions with nuoK mutants

    • Membrane potential measurements using fluorescent probes

    • Oxygen consumption/evolution measurements

    • Bioenergetic parameter calculations (P/O ratios, ATP yield)

    • Isotope labeling experiments to track electron flow

  • Electron transport chain reconfiguration:

    Growth ConditionExpected nuoK FunctionExperimental Approach
    Aerobic chemoheterotrophicActive in respiratory chainO₂ consumption rates with nuoK mutants
    Anaerobic photoheterotrophicPotentially reduced roleCompare growth rates of wild-type vs. nuoK mutants under light
    MicroaerobicMay have intermediate activityMembrane potential measurements at varying O₂ levels
    Nitrogen-fixingMay support increased energy demandCompare nitrogenase activity in WT vs. nuoK mutants

The search results indicate that R. palustris strains are typically grown anaerobically in light at 28°C , conditions under which the photosynthetic apparatus would be active. Under these conditions, the electron transport chain configuration, including the role of nuoK, may differ from aerobic respiratory conditions.

What role might nuoK play in the nitrogen fixation capabilities of R. palustris?

Certain R. palustris strains have been investigated for nitrogen fixation, particularly for potential applications in Mars agriculture . The nitrogenase enzyme requires substantial energy input, and nuoK as part of Complex I may indirectly support this energy-intensive process:

  • Potential mechanisms for nuoK support of nitrogen fixation:

    • Generation of proton motive force for ATP synthesis

    • Maintenance of cellular redox balance

    • Support of microaerobic conditions required for nitrogenase activity

  • Methodological approaches to investigate this relationship:

    • Construction of nuoK deletion or point mutants in nitrogen-fixing strains

    • Comparative acetylene reduction assays (a proxy for nitrogenase activity)

    • Measurement of ATP/ADP ratios in wild-type vs. nuoK mutant strains

    • Transcriptomic analysis of nuoK expression under nitrogen-fixing conditions

  • Strain-specific considerations:
    The engineered strain NifA* mentioned in research has enhanced nitrogen fixation capabilities and would be an interesting background for nuoK studies. This strain performed better than PB23 in scaled-up growth conditions despite PB23 showing more rapid growth at small scales .

The relationship between nuoK function and nitrogen fixation is particularly relevant for applications where R. palustris is being investigated for producing fixed nitrogen fertilizers for Mars missions .

What is the relationship between nuoK function and the plant growth promotion capabilities of certain R. palustris strains?

R. palustris strain PS3 shows significant plant growth-promoting effects compared to strain YSC3 . While nuoK is not specifically mentioned in this context, energy metabolism differences between strains might contribute to their different capabilities:

  • Potential mechanisms linking energy metabolism and plant growth promotion:

    • More efficient energy generation supporting IAA (indole-3-acetic acid) biosynthesis

    • Enhanced nitrogen fixation capabilities requiring robust electron transport

    • Support for metabolite production that benefits plant growth

    • Improved bacterial colonization and persistence in the rhizosphere

  • Methodological approaches to investigate this relationship:

    • Comparative proteomics of nuoK and related genes in PS3 vs. YSC3 strains

    • Construction of nuoK mutants in PS3 to assess impact on plant growth promotion

    • Plant growth experiments with wild-type and nuoK-modified strains

    • Root colonization efficiency measurements between strains and their nuoK mutants

  • Specific plant-bacteria interaction studies:

    • Analysis of IAA production capacity in relation to energy metabolism

    • Plant nitrogen uptake efficiency measurements as described in research

    • Gene expression analysis during root colonization

Research shows that PS3 enhances nitrate uptake efficiency and stimulates endogenous auxin accumulation in plants . These processes might indirectly depend on efficient energy metabolism supported by properly functioning nuoK. The nitrogen use efficiency (NUE) of PS3-inoculated plants was dramatically higher than that of YSC3-inoculated plants, with PS3 enabling 6.78g of dry weight harvested per gram of N applied, compared to only 3.64g for YSC3 .

How can you establish an in vitro assay system to measure nuoK activity within Complex I?

Developing reliable activity assays for nuoK function within Complex I presents several challenges:

  • Preparation of experimental components:

    • Isolation of intact membrane vesicles from R. palustris

    • Purification of holo-Complex I with verified composition

    • Reconstitution of purified Complex I into proteoliposomes

    • Preparation of nuoK-deficient Complex I for complementation studies

  • Activity measurement approaches:

    • NADH:ubiquinone oxidoreductase activity assays

    • Proton pumping measurements using pH-sensitive dyes

    • Membrane potential generation using voltage-sensitive probes

    • Site-specific spectroscopic techniques for electron transfer kinetics

  • Controls and validation:

    • Inhibitor studies (rotenone, piericidin A) to confirm specificity

    • Comparison with well-characterized Complex I from model organisms

    • Mutagenesis of conserved residues to confirm structure-function relationships

  • Quantitative parameters to measure:

    ParameterMeasurement TechniqueExpected Range
    VmaxNADH oxidation rate1-5 μmol/min/mg protein
    Km for NADHVarying NADH concentrations5-20 μM
    Km for ubiquinoneVarying Q concentrations10-50 μM
    H⁺/e⁻ ratioSimultaneous e⁻ transfer and H⁺ uptake3-4 H⁺/2e⁻
    Inhibitor sensitivityIC50 determinationsStrain-dependent

These methodological approaches would help understand the specific role of nuoK in the energy metabolism of R. palustris strains with different capabilities, such as the nitrogen-fixing strains described in research .

What techniques can be used to investigate the interaction between nuoK and other subunits of Complex I in R. palustris?

Understanding protein-protein interactions involving nuoK is essential for elucidating its role in Complex I assembly and function:

  • Crosslinking approaches:

    • Chemical crosslinking with MS identification of linked peptides

    • Site-specific photocrosslinking using unnatural amino acid incorporation

    • In vivo crosslinking followed by co-immunoprecipitation

    • Distance constraint determination for structural modeling

  • Biophysical interaction methods:

    • Blue Native PAGE to analyze intact complexes

    • Förster Resonance Energy Transfer (FRET) between labeled subunits

    • Surface Plasmon Resonance (SPR) with immobilized subunits

    • Isothermal Titration Calorimetry (ITC) for interaction energetics

  • Genetic interaction analysis:

    • Suppressor mutation screening

    • Bacterial two-hybrid assays adapted for membrane proteins

    • In vivo site-specific disulfide crosslinking

    • Synthetic genetic array analysis to identify functional relationships

  • Computational interaction prediction:

    • Coevolution analysis to identify interacting residues

    • Molecular docking simulations

    • Molecular dynamics of subunit interfaces

    • Sequence-based interaction site prediction

How can transcriptomics and proteomics be applied to understand nuoK expression regulation in R. palustris?

Understanding how nuoK expression is regulated under different conditions provides insights into its role in R. palustris metabolism:

  • Transcriptomic approaches:

    • RNA-Seq under various growth conditions (aerobic, anaerobic, photosynthetic)

    • Quantitative RT-PCR targeting nuoK and related genes

    • Transcriptional start site mapping using 5' RACE

    • Promoter analysis and identification of regulatory elements

  • Proteomic strategies:

    • Global proteomic profiling under different growth conditions

    • Targeted proteomics (PRM/MRM) for nuoK quantification

    • Post-translational modification analysis

    • Protein turnover rate determination using pulse-chase experiments

    • Membrane proteome enrichment techniques

  • Integration of multi-omics data:

    • Correlation analysis between transcriptomic and proteomic datasets

    • Regulatory network reconstruction

    • Metabolic flux analysis incorporating expression data

  • Experimental design considerations:

    Growth ConditionRelevant to ApplicationKey Parameters to Monitor
    Photosynthetic anaerobicBasic physiologyLight intensity, carbon source
    N₂-fixing conditionsFertilizer production N source, O₂ level
    Plant root exudate exposurePlant growth promotion Exudate composition, pH
    Carbon limitationMetabolic versatilityC/N ratio, growth rate

Understanding nuoK regulation could help explain the physiological differences between R. palustris strains like PS3 and YSC3 described in research , particularly regarding their differential effects on plant nitrogen use efficiency.

What are the best heterologous expression systems for characterizing R. palustris nuoK?

Selecting an appropriate expression system is critical for successful characterization of membrane proteins like nuoK:

  • Comparison of expression systems:

    Expression SystemAdvantagesDisadvantagesYield Expectations
    E. coli (C41/C43)Well-established protocols, genetic toolsMay not fold properly0.1-1 mg/L culture
    R. palustris (homologous)Native folding environmentLower yields, slower growth0.05-0.2 mg/L culture
    Yeast (P. pastoris)Eukaryotic machinery, high biomassDifferent membrane composition0.5-2 mg/L culture
    Cell-free systemsAvoids toxicity issuesExpensive, limited scale0.1-0.5 mg/reaction
    Insect cellsGood for complex membrane proteinsComplex media, higher cost1-5 mg/L culture
  • Methodological considerations:

    • Selection of appropriate detergents for extraction and purification

    • Design of constructs with solubility-enhancing fusion partners

    • Optimization of induction conditions and expression temperature

    • Development of activity assays compatible with different host backgrounds

  • Validation of heterologous expression:

    • Western blotting with anti-tag or specific antibodies

    • Mass spectrometry to confirm protein identity

    • Circular dichroism to assess secondary structure integrity

    • Functional reconstitution in proteoliposomes

Based on research describing cultivation of R. palustris under anaerobic conditions in light , researchers might need to consider how different expression hosts will affect the folding and function of nuoK, which naturally exists in a photosynthetic membrane environment.

How can you overcome challenges in purifying functional recombinant nuoK protein?

Membrane proteins like nuoK present specific purification challenges that require troubleshooting:

  • Common challenges and solutions:

    ChallengePotential SolutionsSuccess Indicators
    Low expression levelsOptimize codon usage, use strong promotersVisible band on Western blot
    Inclusion body formationLower expression temperature, use solubility tagsIncreased detergent-extractable fraction
    Protein instabilityScreen buffer compositions, add stabilizing lipidsImproved retention of activity
    Aggregation during purificationTest different detergents, use amphipolsMonodisperse peak on size exclusion
    Loss of activityInclude native lipids, gentle purification conditionsRetained NADH oxidation activity
  • Detergent screening strategy:

    • Initial extraction comparison with 5-8 different detergents

    • Stability assessment in each detergent over time

    • Activity measurements to identify function-preserving conditions

    • Scale-up with optimal detergent combination

  • Alternative purification strategies:

    • Styrene maleic acid lipid particles (SMALPs) extraction

    • Native nanodiscs formation during purification

    • Lipid cubic phase methods

    • Detergent-free approaches using novel polymers

These purification strategies need to be adapted based on the specific growth requirements of R. palustris strains, which according to research include anaerobic light conditions at 28°C .

How do you interpret contradictory results when studying nuoK function in different R. palustris strains?

Researchers may encounter conflicting results when comparing nuoK function across different strains:

  • Sources of strain-dependent variations:

    • Genetic background differences affecting compensatory pathways

    • Different isoforms or paralogs of nuoK with varied functions

    • Strain-specific regulatory networks affecting expression

    • Metabolic differences altering the importance of Complex I

  • Methodological approaches to resolve contradictions:

    • Standardize experimental conditions across strain comparisons

    • Perform genetic complementation experiments

    • Create hybrid strains with nuoK gene swaps

    • Use controlled expression systems to normalize expression levels

    • Isolate membranes from different strains for in vitro comparisons

  • Data integration approaches:

    • Meta-analysis of results from multiple strains

    • Statistical methods to account for strain variance

    • Identification of common principles versus strain-specific features

    • Construction of predictive models incorporating strain differences

The strain variations described in research, where different R. palustris strains show distinct capabilities in plant growth promotion and nitrogen fixation , suggest that similar variations might exist in nuoK function and importance. For example, strain NifA* performed better than PB23 in scaled-up cultivation despite PB23 showing more rapid growth at small scale .

What control experiments are essential when characterizing nuoK mutants in R. palustris?

  • Genetic controls:

    • Complementation with wild-type nuoK to verify phenotype restoration

    • Empty vector controls for plasmid effects

    • Site-directed mutagenesis controls (non-functional vs. functional mutations)

    • Marker gene insertions at neutral sites to control for insertion effects

  • Physiological controls:

    • Growth under permissive conditions where nuoK is non-essential

    • Parallel testing of multiple independent mutant isolates

    • Wild-type strain processed identically to mutants

    • Testing under various environmental conditions

  • Biochemical controls:

    • Activity measurements of other respiratory chain components

    • General membrane integrity assays

    • ATP synthesis capacity via alternative pathways

    • Redox balance indicators (NAD⁺/NADH ratio)

  • Control checklist for different experiment types:

    Experiment TypeEssential ControlsPurpose
    Growth phenotypingWT strain, complemented strainVerify mutation causality
    Enzyme assaysHeat-inactivated samples, inhibitor controlsEstablish specificity
    TranscriptomicsHousekeeping gene validation, RT controlsEnsure data quality
    In vivo functionMultiple growth conditionsDistinguish direct vs. indirect effects

These controls are particularly important when studying nuoK in the context of complex phenotypes like plant growth promotion described in research , where multiple factors may contribute to the observed effects.

How might nuoK engineering contribute to optimizing R. palustris for nitrogen fixation applications?

R. palustris strains are being investigated for nitrogen fixation applications, including potential use on Mars :

  • Engineering strategies targeting nuoK:

    • Modify nuoK to enhance proton pumping efficiency, potentially increasing ATP availability for nitrogenase

    • Engineer nuoK variants that function optimally under the microaerobic conditions preferred for nitrogen fixation

    • Create oxygen-tolerant variants to support nitrogenase activity in fluctuating oxygen environments

    • Adjust nuoK expression levels to balance energy production with cellular needs

  • Integration with broader metabolic engineering:

    • Coordinate nuoK modifications with nitrogenase improvements

    • Balance electron flux between respiratory and nitrogen fixation pathways

    • Engineer redox sensing through nuoK to regulate nitrogenase expression

    • Optimize growth-nitrogen fixation trade-offs through energy metabolism tuning

  • Application-specific considerations:

    ApplicationRelevant R. palustris StrainnuoK Engineering Goal
    Mars fertilizer production NifA*Optimize for low temperature function
    Sustainable agriculturePS3 Enhance root colonization efficiency
    Biofertilizer developmentPB23 Balance growth rate and N₂ fixation
    Bioremediation systemsVarious strainsFunction in contaminated environments
  • Methodological approach for engineering assessment:

    • Growth and nitrogen fixation measurements under simulated application conditions

    • Comparative performance in soil/hydroponic systems as described in research

    • Evaluation of fixed nitrogen release for plant uptake

    • Long-term stability and genetic consistency testing

What novel analytical techniques could advance our understanding of nuoK in situ function?

Developing new techniques to study nuoK in its native membrane environment could provide unprecedented insights:

  • Emerging structural biology approaches:

    • Cryo-electron tomography of R. palustris membranes

    • Single-particle cryo-EM of intact Complex I

    • Integrative structural modeling combining multiple data sources

    • In-cell NMR techniques adapted for membrane proteins

  • Advanced spectroscopic methods:

    • Time-resolved electron paramagnetic resonance

    • 2D infrared spectroscopy for proton dynamics

    • Single-molecule FRET for conformational changes

    • Mass spectrometry of intact membrane complexes

  • Genetic and molecular biology innovations:

    • CRISPR interference for tunable gene expression

    • Optogenetic control of nuoK expression or function

    • In vivo biosensors for local proton gradient detection

    • Proximity labeling to map the dynamic interactome

  • Computational method development:

    • Quantum mechanics/molecular mechanics simulations of proton pumping

    • Machine learning for prediction of nuoK variants with desired properties

    • Systems biology models incorporating nuoK function

    • Evolutionary analysis to understand nuoK adaptation

These advanced techniques could help clarify the specific role of nuoK in the various applications of R. palustris described in research, including nitrogen fixation and plant growth promotion .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.