Recombinant Rhodopseudomonas palustris Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
kdpC; Rpal_3411; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain TIE-1)
Target Names
kdpC
Target Protein Sequence
MLKEVRPAVVSLLALTMITGLAYPLAVTGLATVLFPYQAQGSLVERGGKVVGSALIGQEF KGDEYFHGRPSATVAPDPADSSKTVSAPYNAANSGGSNLGPTSKALADRLSEDVAKLKAE NPAAPIPVDLVTTSGSGLDPDISPEGALFQVPRVAKARGVTEEQIRKLVGASIEQPLGGV LGESRVNVLKLNLALDAAAPR
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of KdpC in the KdpFABC complex of Rhodopseudomonas palustris?

The functional role of KdpC in the KdpFABC complex remains partially characterized, with current evidence suggesting it may function similarly to β subunits of Na+/K+ ATPases. Based on structural analysis, KdpC is located in proximity to the selectivity filter of the complex, indicating a potential regulatory role . Unlike KdpB (the P-type ATPase subunit responsible for ATP hydrolysis) and KdpA (initially thought to be solely responsible for K+ transport), KdpC exhibits minimal conformational changes during the transport cycle, suggesting a stabilizing rather than catalytic function .

To investigate KdpC's function, researchers typically employ:

  • Site-directed mutagenesis targeting conserved residues

  • Co-immunoprecipitation to identify protein-protein interactions

  • Fluorescence resonance energy transfer (FRET) experiments to detect conformational coupling

  • Complementation assays in kdpC knockout strains

The current model suggests KdpC may regulate the interaction between KdpA and KdpB subunits, facilitating the unique transport mechanism where K+ ions may traverse through two half-channels formed by KdpA and KdpB rather than exclusively through KdpA as previously assumed .

What expression systems are most effective for producing recombinant R. palustris KdpC?

Successful recombinant expression of R. palustris KdpC requires careful selection of expression systems based on experimental objectives. For structural studies requiring high protein yields, E. coli-based systems using pBBRMCS-5 or similar vectors have proven effective for expressing components of R. palustris . When expressing KdpC, consider the following methodological approaches:

  • Homologous expression in R. palustris:

    • Advantages: Native post-translational modifications, proper folding

    • Method: Transform constructed plasmids (e.g., pBBR-kdpC) from E. coli S17-1 to R. palustris via conjugation

    • Typical growth conditions: 30°C in PM medium supplemented with 20 mM sodium acetate

  • Heterologous expression in E. coli:

    • Advantages: Higher yields, easier manipulation

    • Recommended strains: BL21(DE3) for high expression; C41(DE3) or C43(DE3) for membrane proteins

    • Purification strategy: Ni-NTA affinity chromatography for His-tagged constructs

  • Cell-free expression systems:

    • Advantages: Rapid production, suitable for toxic proteins

    • Implementation: Commercial kits based on E. coli or wheat germ extracts

For functional studies, co-expression of the entire KdpFABC complex is often necessary since the KdpA subunit alone does not support potassium uptake, indicating the interdependence of the subunits .

How can researchers verify the structural integrity of recombinant KdpC?

Verifying the structural integrity of recombinant KdpC is essential before proceeding with functional analyses. A multi-technique approach is recommended:

  • Circular Dichroism (CD) Spectroscopy:

    • Method: Compare the secondary structure profile of recombinant KdpC with predicted values

    • Analysis: Typical α-helical content should match computational predictions based on homology models

  • Limited Proteolysis:

    • Implementation: Treat purified KdpC with proteases (trypsin, chymotrypsin) at varying concentrations

    • Analysis: Well-folded proteins exhibit characteristic digestion patterns reflecting accessible regions

  • Thermal Shift Assays:

    • Method: Monitor protein unfolding using fluorescent dyes that bind to hydrophobic regions

    • Data interpretation: Compare melting temperatures (Tm) with and without ligands/interaction partners

  • Native PAGE and Size Exclusion Chromatography:

    • Purpose: Assess oligomeric state and homogeneity

    • Analysis: Compare with expected molecular weight and profile of native KdpC

  • Cryo-EM Analysis (for the entire KdpFABC complex):

    • Current resolution standards: 3.7-4.0Å for high-quality structural determination

    • Key features to examine: KdpC's position relative to the selectivity filter region

Combining these techniques provides a comprehensive assessment of recombinant KdpC's structural integrity before proceeding with more resource-intensive functional studies.

What is the mechanism of interaction between KdpC and other subunits in the chimeric KdpFABC complex?

The KdpFABC complex represents a fascinating chimeric system that combines elements of actively pumping P-type ATPases with the high affinity and selectivity of potassium channels . KdpC's interaction with other subunits appears critical to this unique functionality:

  • Structural Basis of Interactions:

    • Cryo-EM structures at 3.7Å and 4.0Å resolution reveal KdpC's proximity to the selectivity filter

    • KdpC likely stabilizes the complex in both E1 and E2 conformational states

    • Unlike other subunits, KdpC exhibits minimal conformational changes between states

  • Proposed Interaction Mechanism:

    • KdpC may function analogously to β subunits of Na+/K+ ATPases

    • It likely facilitates communication between the ATP-hydrolyzing KdpB subunit and the K+-selective pathway

    • KdpC appears essential for maintaining the structural integrity required for the novel translocation pathway through two half-channels formed by KdpA and KdpB

  • Experimental Evidence:

    • Expression of KdpA alone does not support potassium uptake, indicating the requirement for interaction with other subunits

    • The alternating access mechanism (with outward-facing E1 and inward-facing E2 states) appears reversed compared to classical P-type ATPases, suggesting unique conformational coupling

  • Methodological Approaches to Study These Interactions:

    • Crosslinking studies to capture transient interactions during the transport cycle

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Molecular dynamics simulations to predict conformational changes and energy landscapes

This complex mechanism allows KdpFABC to function as a true chimera, synergizing the best features of otherwise separately evolved transport mechanisms to achieve both high selectivity and active transport against substantial concentration gradients .

How does the expression of kdpC in R. palustris respond to environmental stressors?

The regulation of kdpC expression in R. palustris under environmental stresses remains incompletely characterized, but researchers can adapt methodologies used for studying related stress responses:

  • Experimental Approaches:

    • qRT-PCR Analysis: Using primers specific to kdpC to quantify transcript levels under various conditions

    • RNA-Seq: For genome-wide expression analysis alongside kdpC

    • Reporter Gene Fusions: Construction of kdpC promoter-GFP fusions to monitor expression in real-time

  • Key Environmental Stressors to Test:

    • Potassium Limitation: Primary trigger for kdp operon induction in many bacteria

    • Salt Stress: Different NaCl concentrations (0%, 1.0%, 2.0%) as used in R. palustris studies

    • Nitrogen Starvation: Important for metabolic shifts in R. palustris

    • Oxidative Stress: ROS levels can be measured using established protocols for R. palustris

    • Dark/Light Transitions: Given R. palustris' photosynthetic capabilities

  • Correlation with Metabolic State:

    • Non-growing R. palustris cells show distinct metabolic profiles, including increased H2 production

    • Expression analysis should account for growth phase (logarithmic vs. stationary)

    • Cells should be harvested at standardized optical densities (e.g., OD660 of 0.8) for consistency

Table 2.3: Hypothetical kdpC Expression Patterns Under Various Stressors

Environmental ConditionRelative kdpC ExpressionAssociated Metabolic ChangesProposed Regulatory Mechanism
K+ limitation (50 μM)15-25 fold increaseReduced growth rateTwo-component system activation
Salt stress (2.0% NaCl)3-5 fold increaseCarotenoid accumulationOsmotic stress response
N2 deprivation1-2 fold increaseH2 production increased, PHB accumulationMetabolic reprogramming
Light deprivation2-3 fold increaseShift to electroautotrophyEnergy conservation strategy
Oxidative stress4-6 fold increaseIncreased antioxidant enzymesProtection of transport systems

Understanding how kdpC expression responds to these stressors could reveal its role beyond potassium homeostasis, potentially contributing to R. palustris' remarkable metabolic versatility including its ability to shift between photoautotrophy, photoheterotrophy, and electroautotrophy .

What role might KdpC play in electrosyntrophic interactions between R. palustris and other species?

The discovery of electrosyntrophic interactions between R. palustris and Geobacter metallireducens presents intriguing possibilities for KdpC's role in interspecies electron transfer and dark carbon fixation :

  • Conceptual Framework:

    • Electrosyntrophy enables R. palustris to fix CO2 in the dark through electron transfer from G. metallireducens

    • The KdpFABC complex's unique chimeric nature may participate in this process beyond simple K+ transport

    • KdpC could function as a regulatory component in adapting to the specialized electron transfer requirements

  • Potential Mechanisms:

    • Electron Shuttle Regulation: KdpC might influence membrane potential or electrochemical gradients affecting electron shuttles

    • Ion Homeostasis Support: Maintaining K+ balance during electrosyntrophic metabolism

    • Signaling Integration: KdpC could connect potassium status with electron transfer pathways

  • Experimental Approaches to Test This Hypothesis:

    • Co-culture Experiments: Compare electrosyntrophic efficiency between wild-type and kdpC mutant R. palustris strains

    • Transcriptomic Analysis: Examine kdpC expression alongside genes for extracellular electron transfer pathways in electrosyntrophic co-cultures

    • Membrane Potential Measurements: Assess the effect of kdpC mutations on membrane potential during electrosyntrophy

    • Electron Microscopy: Visualize membrane structures and potential contact points between species

  • Relevant Gene Expression Patterns:

    • Genes encoding the Calvin-Benson-Bassham cycle are highly expressed during electrosyntrophic growth

    • Cytochrome c2 and Complex III components show elevated expression during electron uptake

    • Examining whether kdpC expression correlates with these patterns could reveal functional connections

This research direction could establish whether KdpC contributes to R. palustris' remarkable ability to perform dark carbon fixation through electrosyntrophy, which represents "an as-yet unappreciated contribution to the global carbon cycle" .

How can cryo-EM techniques be optimized for structural analysis of KdpC within the KdpFABC complex?

Optimizing cryo-EM for structural analysis of KdpC within the larger KdpFABC complex requires addressing several technical challenges:

  • Sample Preparation Optimization:

    • Detergent Selection: Screen detergents beyond standard options (DDM, LMNG) to maintain native lipid interactions

    • Reconstitution Methods: Consider nanodiscs or amphipols to better approximate the membrane environment

    • Concentration Optimization: Test concentration range of 2-5 mg/ml for optimal particle distribution

    • Grid Treatment: Evaluate graphene oxide or ultrathin carbon support films to improve particle orientation distribution

  • Data Collection Strategies:

    • Beam-induced Motion Correction: Implement frame-based motion correction algorithms

    • Dose Fractionation: Optimize electron dose across multiple frames (typically 40-50 e-/Å2 total)

    • Defocus Range: Collect data across -0.8 to -2.5 μm defocus for comprehensive CTF correction

    • Tilt Series: Consider collecting at 10-20° tilt to address preferred orientation issues

  • Processing Workflow for Asymmetric Complexes:

    • 2D Classification: Carefully select diverse views to capture conformational heterogeneity

    • 3D Classification: Implement multi-reference classification to separate conformational states (E1 vs E2)

    • Focused Refinement: Apply masks around KdpC to improve local resolution

    • Direct comparison: Analyze structural differences between 3.7Å (E1) and 4.0Å (E2) states

Table 2.5: Optimization Parameters for Cryo-EM Analysis of KdpFABC Complex

ParameterStandard ApproachOptimized for KdpFABCExpected Improvement
Sample concentration3 mg/ml4-5 mg/mlBetter particle density
DetergentDDMLMNG or GDNEnhanced stability
Grid typeQuantifoil R1.2/1.3UltrAuFoil R1.2/1.3Reduced beam-induced motion
Exposure strategy40 e-/Å250 e-/Å2 with 40 framesBetter signal at high resolution
Processing approachGlobal refinementFocused refinement on KdpCImproved local resolution
Particle selectionAuto-pickingManually curated training setReduction of false positives

These optimizations can help achieve resolutions better than the current 3.7-4.0Å , potentially revealing the precise interactions between KdpC and other subunits that enable the unique potassium transport mechanism through two half-channels along KdpA and KdpB, uniting features of P-type ATPases and potassium channels .

What techniques are most effective for studying conformational changes in KdpC during the transport cycle?

Studying conformational changes in KdpC during the potassium transport cycle requires techniques that can capture dynamic structural transitions:

  • Time-Resolved Cryo-EM:

    • Implementation: Trap intermediate states using rapid mixing/freezing techniques

    • Analysis: Compare with established E1 (3.7Å) and E2 (4.0Å) states

    • Advantages: Direct visualization of structural transitions at near-atomic resolution

  • Single-Molecule FRET:

    • Strategy: Introduce fluorophore pairs at key positions in KdpC and other subunits

    • Data interpretation: FRET efficiency changes reflect distance changes during transport

    • Key advantage: Can measure conformational dynamics in real-time and in native-like environments

  • EPR Spectroscopy:

    • Method: Site-directed spin labeling of cysteine residues introduced at strategic positions

    • Analysis: Continuous wave or pulsed EPR to measure distances between labels

    • Strength: Can detect subtle conformational changes with high sensitivity

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Implementation: Monitor deuterium incorporation rates in different functional states

    • Data analysis: Regions with altered exchange rates indicate conformational differences

    • Advantage: Provides region-specific information without requiring protein modification

  • Molecular Dynamics Simulations:

    • Approach: Build models based on cryo-EM structures in E1 and E2 states

    • Analysis: Calculate free energy landscapes for conformational transitions

    • Integration: Validate computational predictions with experimental data

Although KdpC shows minimal conformational changes compared to other subunits of the complex , understanding these subtle transitions is crucial for elucidating how KdpC contributes to the novel mechanism where potassium ions may traverse through two half-channels formed by KdpA and KdpB rather than exclusively through KdpA .

How can researchers effectively generate and characterize kdpC knockout strains in R. palustris?

Creating and characterizing kdpC knockout strains in R. palustris requires specialized techniques due to the organism's unique properties:

  • Gene Knockout Methodology:

    • Suicide Plasmid Construction: Follow established protocols using primers designed for kdpC

    • Conjugation Transfer: Transform constructed plasmids from E. coli S17-1 to R. palustris via conjugation

    • Selection Strategy: Implement two-step selection process with appropriate antibiotics

    • Verification: Confirm deletion using PCR with primers flanking the target region

  • Phenotypic Characterization:

    • Growth Analysis: Compare growth rates in media with varying potassium concentrations

    • Potassium Transport Assays: Measure 86Rb+ uptake rates in wild-type versus knockout strains

    • Metabolic Profiling: Assess changes in hydrogen production and carbon fixation

    • Salt Tolerance Testing: Evaluate growth at various NaCl concentrations (0%, 1.0%, 2.0%)

  • Molecular Characterization:

    • Transcriptomic Analysis: RNA extraction and qRT-PCR to assess compensatory gene expression

    • Proteomic Analysis: Examine changes in membrane protein composition

    • Electron Microscopy: Evaluate membrane structure integrity

  • Complementation Studies:

    • Vector Selection: pBBRMCS-5 or similar vectors have proven effective for complementation in R. palustris

    • Expression Verification: Confirm kdpC expression in complemented strains via Western blotting

    • Functional Rescue: Assess restoration of wild-type phenotypes

These approaches will help determine whether KdpC is essential for potassium transport in R. palustris or if its role is more regulatory, potentially contributing to the unique chimeric function of the KdpFABC complex that combines features of P-type ATPases and potassium channels .

What are the most promising future research directions for understanding KdpC function in R. palustris?

Based on current knowledge gaps and emerging areas of interest, several promising research directions for R. palustris KdpC warrant further investigation:

  • Structure-Function Relationship Refinement:

    • Obtaining higher-resolution structures of KdpC within the KdpFABC complex in various conformational states

    • Detailed mapping of interaction interfaces between KdpC and other subunits

    • Characterizing the molecular basis for KdpC's proposed role as analogous to β subunits of Na+/K+ ATPases

  • Metabolic Integration Studies:

    • Investigating potential links between KdpC function and R. palustris' remarkable metabolic versatility

    • Exploring how KdpC contributes to potassium homeostasis during transitions between photoheterotrophic, photoautotrophic, and electroautotrophic growth modes

    • Examining KdpC's role in supporting hydrogen production under nitrogen-limited conditions

  • Environmental Adaptation Mechanisms:

    • Characterizing how KdpC functions under various stress conditions

    • Investigating potential coordination between potassium transport and carotenoid synthesis for salt tolerance

    • Examining KdpC's contribution to electrosyntrophic interactions in microbial communities

  • Applied Biotechnology Applications:

    • Exploring how engineered modifications to KdpC might enhance R. palustris' capabilities for biofuel production

    • Investigating potential applications in bioelectrochemical systems leveraging R. palustris' electrosyntrophic capabilities

    • Developing KdpC-based biosensors for environmental monitoring

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.