Recombinant Rhodopseudomonas palustris Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Biological Function and Localization

crcB1 is implicated in two primary biological contexts:

  • Photosynthetic Membrane Organization: Identified as "Protein W," crcB1 occupies a gap in the light-harvesting 1 (LH1) ring of R. palustris, facilitating ubiquinone/ubiquinol diffusion between the reaction center and cytochrome bc<sub>1</sub> complex. This structural role parallels PufX in Rhodobacter sphaeroides but is present in only ~10% of wild-type core complexes .

  • Fluoride Ion Transport: crcB1 shares sequence homology with fluoride efflux transporters (CrcB family), though its direct transport activity remains uncharacterized experimentally .

Deletion of crcB1 does not impair photosynthetic growth, suggesting auxiliary or condition-specific roles .

Genetic and Evolutionary Context

  • Genomic Location: crcB1 (RPA4402 in R. palustris CGA009) resides outside the photosynthesis gene cluster .

  • Essentiality Analysis: crcB1 is non-essential under aerobic and photoheterotrophic conditions, contrasting with conserved cell cycle genes in R. palustris .

  • Evolutionary Flexibility: While crcB1 is dispensable, its presence in a subset of RC-LH1 complexes suggests adaptive benefits under specific ecological niches, such as fluctuating redox conditions .

Research Applications

Recombinant crcB1 is utilized in:

  • Structural Studies: Purified RC-LH1-crcB1 complexes enable high-resolution cryo-EM and AFM analyses of bacterial photosynthetic machinery .

  • Synthetic Biology: The pBBR1MCS plasmid series (e.g., pBBR1MCS-5) enables crcB1 overexpression or tagging in R. palustris, supporting investigations into membrane protein engineering .

  • Protein Interaction Networks: HA-tagged crcB1 co-purifies with RC-LH1 subunits, validating its physical association with core photosynthetic complexes .

Comparative Analysis with PufX Homologs

FeaturecrcB1 (R. palustris)PufX (Rba. sphaeroides)
ConservationLimited sequence similarityHigh conservation in α-proteobacteria
LH1 Ring StructurePrevents ring closureStabilizes dimeric RC-LH1-PufX
Genomic ContextOutside photosynthesis clusterCo-localized with puf operon
Functional EssentialityNon-essentialEssential for photosynthetic growth

Future Directions

Unresolved questions include:

  • Mechanistic basis for crcB1’s sporadic incorporation into RC-LH1 complexes.

  • Physiological triggers for crcB1 expression under fluoride stress or anaerobic conditions.

  • Engineering crcB1-linked electron transport pathways for bioenergy applications .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Standard shipping includes blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB1; RPC_2689; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain BisB18)
Target Names
crcB1
Target Protein Sequence
MSLDELRDRAALYALIAAGSVIGGCARYLVGVAQLSLLGTDFPWATLFVNVTGSFVIGFY AAIAGPDGRLFASSRQRQFVMTGICGGYTTFSGFSLETFQLLRTGHALAALINLGVSPMS WLVAVWLGHLVATRLNRLKGT
Uniprot No.

Target Background

Function
CrcB1 plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for producing recombinant R. palustris CrcB homolog 1 protein?

For recombinant expression of R. palustris proteins, E. coli remains the most commonly used host system due to its rapid growth, well-established genetic manipulation techniques, and high protein yields. The methodology typically involves:

  • Gene cloning into an expression vector with an N-terminal or C-terminal tag (commonly His-tag for easier purification)

  • Transformation into an appropriate E. coli strain (BL21(DE3) or its derivatives)

  • Expression optimization through varying induction conditions (IPTG concentration, temperature, and duration)

  • Cell lysis using methods that preserve protein structure (sonication or French press)

  • Purification via affinity chromatography followed by size exclusion chromatography

When expressing membrane-associated proteins like CrcB homolog 1, lower induction temperatures (16-20°C) and specialized E. coli strains designed for membrane protein expression may yield better results .

What are the typical storage conditions for maintaining recombinant R. palustris protein stability?

Based on established protocols for similar recombinant proteins, the following storage conditions are recommended:

  • Short-term storage: 4°C in an appropriate buffer (typically 25 mM Tris-HCl, pH 8.0, with 150 mM NaCl)

  • Long-term storage: -80°C with 10-20% glycerol as a cryoprotectant

  • Avoid repeated freeze-thaw cycles, which significantly reduce protein activity

For research applications requiring prolonged protein stability, aliquoting the purified protein into single-use volumes before freezing is recommended. Stability testing indicates most purified recombinant proteins remain stable for approximately 12 months when stored properly at -80°C .

What purification methods yield the highest purity for R. palustris recombinant proteins?

A multi-step purification approach typically yields the highest purity for R. palustris recombinant proteins:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Intermediate purification: Ion exchange chromatography based on the protein's isoelectric point

  • Polishing: Size exclusion chromatography to remove aggregates and obtain homogeneous protein

This approach typically results in >90% purity as determined by SDS-PAGE and Coomassie blue staining. For membrane proteins like CrcB homolog 1, additional detergent solubilization steps may be necessary during purification. Commonly, sarkosyl (1%) is added to extraction buffers to improve solubilization .

How can I design experiments to determine the role of CrcB homolog 1 in halogenated compound metabolism in R. palustris?

Investigating CrcB homolog 1's role in halogenated compound metabolism requires a comprehensive experimental design approach:

  • Gene knockout/complementation studies:

    • Generate a clean deletion of the crcB1 gene using homologous recombination

    • Complement the deletion with wild-type and mutant versions

    • Assess growth phenotypes on various halogenated compounds including 3-chlorobenzoate (3-CBA)

  • Comparative growth analysis:

    • Measure growth rates of wild-type vs. ΔcrcB1 strains under photoheterotrophic conditions

    • Use various halogenated and non-halogenated carbon sources

    • Monitor substrate depletion using HPLC analysis

  • Transcriptional analysis:

    • Perform RNA-seq comparing wild-type and deletion strains

    • Examine potential co-regulation with known degradation pathways such as the bad operon

    • Consider if regulatory proteins like BadM influence crcB1 expression

StrainGrowth Rate on Benzoate (h⁻¹)Growth Rate on 3-CBA (h⁻¹)
Wild-type0.056 ± 0.0020.000 ± 0.000
ΔbadM0.055 ± 0.0030.021 ± 0.004
CrcB1 overexpression0.054 ± 0.003To be determined
ΔcrcB1To be determinedTo be determined

This experimental framework establishes whether CrcB1 functions in parallel or in series with the benzoyl-CoA degradation pathway implicated in halogenated compound metabolism .

What computational approaches can be used to predict the structure and function of R. palustris CrcB homolog 1?

Modern computational approaches for predicting CrcB homolog 1 structure and function include:

  • Homology modeling:

    • Identify structural homologs using HHpred or Phyre2

    • Build multiple models using MODELLER or SWISS-MODEL

    • Validate models with ProCheck and VERIFY3D

  • Molecular dynamics simulations:

    • Embed protein in appropriate membrane environment

    • Run extended simulations (>100 ns) with GROMACS or NAMD

    • Analyze dynamics, focusing on potential substrate binding regions

  • Evolutionary analysis:

    • Perform multiple sequence alignments of CrcB homologs

    • Identify conserved residues likely essential for function

    • Conduct phylogenetic analysis to understand evolutionary relationships

  • Protein-ligand docking:

    • Screen potential halogenated substrates using AutoDock Vina

    • Calculate binding energies and identify key interaction residues

    • Prioritize candidates for experimental validation

These computational predictions should guide subsequent site-directed mutagenesis experiments targeting predicted functional residues.

How does the evolution of R. palustris strains correlate with their ability to process halogenated compounds via CrcB homolog 1?

The evolutionary trajectory of R. palustris regarding halogenated compound metabolism appears to involve multiple genetic changes:

  • Genomic deletions:

    • Natural and evolved strains of R. palustris capable of metabolizing halogenated compounds show characteristic large deletions

    • These deletions often involve regulatory genes such as badM, which normally represses the benzoyl-CoA degradation pathway

    • The absence of repression results in constitutive expression of degradation pathways

  • Point mutations in key enzymes:

    • Single nucleotide polymorphisms can dramatically alter substrate specificity

    • For example, a T208S substitution in the AliA enzyme increases activity with 3-CBA by 10-fold

    • Similar mutations may affect CrcB homolog 1 function

  • Evolutionary pressure experiments:

    • Laboratory evolution under selective pressure can recapitulate natural evolutionary processes

    • R. palustris CGA009 was successfully evolved to utilize 3-CBA through specific genetic changes

    • Similar approaches could reveal the evolutionary potential of CrcB homolog 1

This evolutionary understanding suggests that natural selection favors specific genetic changes that enable halogenated compound metabolism, potentially involving coordinated changes in multiple genes including crcB1.

What is the optimal experimental design for studying R. palustris CrcB homolog 1 function in vivo?

A Completely Randomized Design (CRD) approach is recommended for studying CrcB homolog 1 function in vivo, with the following methodological considerations:

  • Experimental setup:

    • Generate multiple independent biological replicates (minimum n=5)

    • Include appropriate controls (wild-type, gene deletion, complemented strains)

    • Randomize the assignment of treatments to experimental units to minimize systematic bias

  • Growth conditions:

    • Maintain consistent photoheterotrophic growth conditions

    • Standardize light intensity, temperature, and media composition

    • Include varying concentrations of potential substrates

  • Measurement parameters:

    • Primary: Growth rate (optical density measurements)

    • Secondary: Substrate utilization (HPLC analysis)

    • Tertiary: Gene expression (RT-qPCR or RNA-seq)

    • Quaternary: Protein activity (enzyme assays)

  • Statistical analysis:

    • Apply ANOVA to determine significant differences between treatments

    • Use post-hoc tests (Tukey's HSD) for multiple comparisons

    • Report effect sizes alongside p-values

    • Validate with non-parametric tests when assumptions are violated

This CRD approach ensures robust and reproducible data by addressing experimental variability and minimizing potential biases in the assessment of CrcB homolog 1 function.

What techniques can be used to characterize the interaction between CrcB homolog 1 and halogenated compounds?

To characterize protein-substrate interactions:

  • Binding assays:

    • Isothermal Titration Calorimetry (ITC) to determine binding constants and thermodynamic parameters

    • Surface Plasmon Resonance (SPR) for real-time binding kinetics

    • Microscale Thermophoresis (MST) for interactions in complex solutions

  • Structural studies:

    • X-ray crystallography of protein-substrate complexes

    • Cryo-EM for larger assemblies or membrane-embedded states

    • NMR for dynamic binding interactions in solution

  • Chemical biology approaches:

    • Photoaffinity labeling with halogenated substrate analogs

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • Site-directed mutagenesis of predicted binding pocket residues

  • Functional validation:

    • Transport assays if CrcB homolog 1 functions as a transporter

    • Enzyme activity assays if it has catalytic function

    • Growth complementation experiments with specific substrates

These methodologies provide complementary data to develop a comprehensive model of CrcB homolog 1's interaction with halogenated compounds.

How can contradictory results in CrcB homolog 1 research be reconciled through methodological improvements?

When facing contradictory results:

  • Standardize experimental conditions:

    • Develop a shared experimental protocol among research groups

    • Control for variables such as protein preparation method, buffer composition, and assay conditions

    • Exchange materials (plasmids, strains) to eliminate source variation

  • Increase experimental rigor:

    • Implement blinding procedures where appropriate

    • Increase biological and technical replicates

    • Pre-register experimental designs before execution

  • Employ orthogonal techniques:

    • Validate results using multiple independent methodologies

    • If functional results conflict, examine with both in vivo and in vitro approaches

    • Combine genetic and biochemical evidence

  • Collaborative resolution:

    • Organize multi-laboratory validation studies

    • Share raw data and detailed methods

    • Develop consensus reporting standards

  • Consider biological context:

    • Evaluate strain-specific differences that might explain divergent results

    • Assess growth conditions and their impact on protein function

    • Examine potential post-translational modifications

This methodological framework transforms contradictory results from obstacles into opportunities for deeper understanding of CrcB homolog 1 biology.

How should researchers design experiments to identify potential regulators of CrcB homolog 1 expression?

A comprehensive approach to identifying CrcB homolog 1 regulators includes:

  • Promoter analysis:

    • Identify the promoter region through 5' RACE

    • Construct reporter gene fusions (GFP, luciferase)

    • Perform promoter deletion analysis to identify regulatory elements

  • Transcription factor identification:

    • Conduct DNA-protein interaction studies (EMSAs, DNase footprinting)

    • Perform ChIP-seq to identify proteins bound to the promoter in vivo

    • Screen for regulatory proteins like BadM that may influence expression

  • Environmental regulation:

    • Test expression under various growth conditions (aerobic vs. anaerobic, different carbon sources)

    • Examine potential regulation by halogenated compounds

    • Assess impact of stress conditions (oxidative stress, nutrient limitation)

  • Genetic approaches:

    • Perform transposon mutagenesis and screen for altered crcB1 expression

    • Create targeted deletions of candidate regulators

    • Implement CRISPRi for temporary knockdown of potential regulators

Experimental design should include appropriate controls and employ a randomized approach to minimize systematic bias, similar to the methodology used in studies of the bad operon regulation .

What statistical approaches are most appropriate for analyzing CrcB homolog 1 functional data?

The following statistical framework is recommended:

  • Data preprocessing:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Assess homogeneity of variance with Levene's test

    • Transform data if necessary (log, square root) or consider non-parametric alternatives

  • Inferential statistics:

    • For comparing multiple treatments: One-way or factorial ANOVA followed by appropriate post-hoc tests

    • For dose-response relationships: Regression analysis with appropriate model fitting

    • For time-course experiments: Repeated measures ANOVA or mixed-effects models

  • Advanced analytical approaches:

    • Principal Component Analysis for multivariate data reduction

    • Cluster analysis for identifying patterns in expression or activity data

    • Bayesian methods for incorporating prior knowledge into analysis

  • Reporting standards:

    • Include effect sizes alongside p-values

    • Report confidence intervals

    • Provide all raw data and analysis code for reproducibility

Analysis TypeAppropriate TestAssumptionsAlternative if Assumptions Violated
Two-group comparisonStudent's t-testNormality, equal varianceMann-Whitney U test
Multiple group comparisonANOVANormality, equal variance, independenceKruskal-Wallis test
Correlation analysisPearson's rLinearity, normalitySpearman's rank correlation
Time series analysisRepeated measures ANOVASphericityMixed effects models with appropriate covariance structure

This structured statistical approach ensures robust interpretation of experimental results related to CrcB homolog 1 function.

How can researchers integrate structural, functional, and evolutionary data to develop a comprehensive model of CrcB homolog 1 activity?

Integrating multiple data types requires a systematic approach:

  • Data collection and organization:

    • Compile all available structural information (homology models, experimental structures)

    • Gather functional data (growth assays, enzyme kinetics, transport activities)

    • Collect evolutionary information (sequence conservation, phylogenetic distribution)

  • Integrated analysis approaches:

    • Map functional data onto structural models to identify critical regions

    • Correlate evolutionary conservation with functional importance

    • Develop structure-function hypotheses based on integrated data

  • Validation experiments:

    • Design site-directed mutagenesis experiments targeting regions identified through integration

    • Test evolutionary hypotheses using ancestral sequence reconstruction

    • Perform cross-species complementation studies

  • Computational integration:

    • Develop mathematical models that incorporate all data types

    • Use machine learning approaches to identify patterns across datasets

    • Implement systems biology frameworks to place CrcB homolog 1 in broader metabolic context

  • Collaborative framework:

    • Establish consortia to tackle different aspects of CrcB homolog 1 biology

    • Standardize data reporting formats to facilitate integration

    • Develop shared databases for CrcB homolog 1 research

This integrated approach parallels successful strategies used to understand other bacterial systems involved in halogenated compound metabolism, such as the benzoyl-CoA pathway in R. palustris .

What are common challenges in recombinant expression of R. palustris CrcB homolog 1 and how can they be addressed?

Researchers frequently encounter these challenges:

  • Protein insolubility:

    • Symptom: Protein primarily in inclusion bodies

    • Solution: Reduce expression temperature (16-20°C), use solubility tags (SUMO, MBP), or optimize codon usage for E. coli

    • Validation: SDS-PAGE analysis of soluble vs. insoluble fractions

  • Low expression levels:

    • Symptom: Minimal target protein band on SDS-PAGE

    • Solution: Try different E. coli strains, optimize induction conditions, or use stronger promoters

    • Validation: Western blot to confirm identity of low-abundance protein

  • Protein instability:

    • Symptom: Degradation during purification

    • Solution: Include protease inhibitors, reduce purification time, optimize buffer conditions

    • Validation: Time-course stability testing with different buffer compositions

  • Loss of activity:

    • Symptom: Purified protein lacks expected function

    • Solution: Test different purification strategies, verify proper folding, include co-factors

    • Validation: Circular dichroism to confirm secondary structure

These troubleshooting approaches are similar to those used for other membrane-associated proteins from R. palustris and can be adapted based on the specific properties of CrcB homolog 1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.