Recombinant Rhodopseudomonas palustris UPF0060 membrane protein Rpal_4363 (Rpal_4363)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on blue ice unless otherwise requested. Dry ice shipping is available upon advance request and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this may be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C, and for lyophilized protein, it is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
Rpal_4363; UPF0060 membrane protein Rpal_4363
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain TIE-1)
Target Names
Rpal_4363
Target Protein Sequence
MTSLLTFCAAALMEITGCFAFWAWLRLDKSPLWLIPGMLALALFAYLLTLADSPLAGRAY AAYGGIYIASALLWGWAIEGNRPDQWDVIGAAICLVGMSVILFGPRALPA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhodopseudomonas palustris UPF0060 membrane protein Rpal_4363?

Rhodopseudomonas palustris UPF0060 membrane protein Rpal_4363 is a bacterial membrane protein belonging to the uncharacterized protein family UPF0060. It is derived from the purple non-sulfur bacterium Rhodopseudomonas palustris, a metabolically versatile organism capable of growing in diverse environmental conditions. The protein is characterized by its localization within the bacterial membrane and belongs to a group of proteins whose specific functions remain to be fully elucidated. As a recombinant protein, it is produced through molecular cloning techniques where the gene encoding Rpal_4363 is isolated, amplified, and expressed in a suitable host system .

What experimental approaches are recommended for initial characterization of recombinant Rpal_4363?

Initial characterization of recombinant Rpal_4363 should follow a structured experimental design with clearly defined variables. Begin with:

  • Expression optimization: Test multiple expression systems (E. coli, yeast, insect cells) with varying induction conditions to determine optimal protein yield.

  • Purification strategy development: Implement a multi-step purification process involving:

    • Initial capture using affinity chromatography (if tagged)

    • Intermediate purification via ion exchange chromatography

    • Polishing step using size exclusion chromatography

  • Basic biophysical characterization:

    • SDS-PAGE for purity assessment and MW confirmation

    • Western blot for identity verification

    • Circular dichroism for secondary structure analysis

    • Dynamic light scattering for homogeneity evaluation

Each of these steps should follow the key experimental design principle of clearly defining your dependent and independent variables while controlling for potential confounding factors .

How should researchers approach membrane protein solubilization for Rpal_4363?

When solubilizing Rpal_4363, researchers should implement a systematic screening approach:

Protocol overview:

  • Express the protein in your optimized system

  • Harvest cells and prepare membrane fractions through differential centrifugation

  • Screen multiple detergents using the following matrix approach:

Table 1. Detergent Screening Matrix for Rpal_4363 Solubilization

Detergent ClassExample DetergentsConcentration RangeBuffer Conditions
Non-ionicDDM, LMNG, Triton X-1000.5-2% (w/v)pH 7.0-8.0, 150-300 mM NaCl
ZwitterionicCHAPS, Fos-Choline0.5-1.5% (w/v)pH 7.0-8.0, 150-300 mM NaCl
Newer amphipolsPMAL-C8, SMA0.1-0.5% (w/v)pH 7.0-8.0, 150-300 mM NaCl
  • Incubate membrane fractions with detergents for 1-3 hours at 4°C with gentle agitation

  • Centrifuge at 100,000 × g for 1 hour to separate solubilized proteins

  • Analyze supernatant for protein content and activity

This methodical approach allows for systematic identification of conditions that maintain both structural integrity and functional activity of Rpal_4363 .

What within-subjects experimental design considerations should be applied when investigating Rpal_4363 functional activity?

When designing within-subjects experiments for Rpal_4363 functional characterization, researchers should consider several critical factors:

  • Control for carryover effects: Design your experiment to randomize the order of conditions to minimize systematic bias. For example, when testing Rpal_4363 function under various pH conditions, don't simply progress from acidic to basic; instead, create a randomized testing sequence.

  • Establish appropriate washout periods: When testing multiple conditions with the same protein preparation, ensure sufficient equilibration time between measurements to prevent condition interference.

  • Define appropriate technical replicates: Implement a nested design approach where:

    • Each protein preparation serves as its own control

    • Multiple independent protein preparations are tested (biological replicates)

    • Each preparation undergoes multiple measurements (technical replicates)

  • Account for protein stability over time: Include time-matched controls throughout your experiment to account for potential activity loss during experimental duration.

This approach aligns with experimental design best practices by properly controlling variables and accounting for within-subject variation . Specifically, you must carefully operationalize both your independent variables (experimental conditions) and dependent variables (functional readouts) while accounting for potential confounding factors like protein degradation or instrument drift.

How can researchers distinguish between functional and structural effects when analyzing Rpal_4363 mutants?

Distinguishing between functional and structural effects requires a systematic, multi-technique approach:

This comprehensive approach allows researchers to differentiate between mutations that directly impact function versus those that disrupt structure and indirectly affect function. The data can be organized in a comparative table format:

Table 2. Structural vs. Functional Impact Analysis for Rpal_4363 Variants

VariantCD Similarity (%)ΔTm (°C)SEC-MALS ProfileActivity (% of WT)Interpretation
WT1000Monomer100Reference
K45A98-1.2Monomer45Functional effect
D112N95-0.8Monomer38Primarily functional
G78V75-8.5Aggregation12Structural disruption
P55G82-4.2Mixed species25Combined effect

By systematically analyzing these parameters, researchers can make evidence-based determinations regarding the nature of mutational effects .

What strategies can address data contradictions when characterizing Rpal_4363 behavior in different membrane environments?

When faced with contradictory data regarding Rpal_4363 behavior across different membrane environments, implement this systematic troubleshooting approach:

  • Data validation through methodological triangulation:

    • Confirm findings using at least three independent techniques

    • For example, if fluorescence spectroscopy and circular dichroism disagree about structural changes, add FTIR or NMR measurements

  • Controlled parameter isolation:

    • Systematically vary one membrane component at a time

    • Create phase diagrams mapping protein behavior across lipid compositions

    • Distinguish between bulk lipid effects and specific lipid interactions

  • Time-resolved measurements:

    • Assess protein behavior across multiple time points after reconstitution

    • Differentiate between kinetic and equilibrium effects

  • Reconstitution method comparison:

    • Test multiple reconstitution techniques (e.g., detergent dialysis, direct incorporation, liposome fusion)

    • Evaluate how the reconstitution process itself may influence measurements

  • Data integration framework:

    • Develop a hypothesis-driven model that explains apparent contradictions

    • Test predictions of your model with new experiments designed to specifically address discrepancies

This systematic approach allows researchers to reconcile contradictory observations and develop a comprehensive understanding of how membrane environments modulate Rpal_4363 structure and function .

How should researchers optimize recombinant expression systems for maximum yield of functional Rpal_4363?

Optimizing recombinant expression of Rpal_4363 requires a structured experimental approach:

  • Host strain selection:

    • Test multiple E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), Lemo21(DE3))

    • Consider alternative expression hosts (P. pastoris, insect cells) if E. coli yields are insufficient

  • Expression vector optimization:

    • Compare constructs with different promoters (T7, tac, arabinose-inducible)

    • Test various fusion tags (His6, MBP, SUMO) for enhanced solubility

    • Optimize codon usage for expression host

  • Induction parameter matrix:

    • Systematically vary temperature (15-30°C), inducer concentration, and induction time

    • Use a Design of Experiments (DoE) approach to efficiently explore parameter space

Table 3. Optimized Expression Conditions for Rpal_4363

ParameterRange TestedOptimal ConditionYield Improvement
E. coli strainBL21(DE3), C41(DE3), C43(DE3)C43(DE3)2.8-fold
Growth mediaLB, TB, autoinductionTB + 0.5% glucose3.2-fold
Induction temperature15°C, 20°C, 25°C, 30°C20°C4.1-fold
IPTG concentration0.1-1.0 mM0.2 mM1.3-fold
Induction time4h, 8h, 16h, 24h16h1.9-fold
AdditivesGlycerol, sorbitol, betaine5% glycerol + 0.4M betaine2.2-fold
  • Membrane fraction preparation optimization:

    • Compare cell disruption methods (sonication, high-pressure homogenization, enzymatic lysis)

    • Optimize buffer composition to stabilize the protein during extraction

Following this systematic approach will maximize both yield and functional quality of the recombinant Rpal_4363 protein .

What analytical techniques provide the most insight into Rpal_4363 structure-function relationships?

A comprehensive analytical approach to Rpal_4363 structure-function relationships should include:

  • High-resolution structural techniques:

    • X-ray crystallography (if crystals can be obtained)

    • Cryo-electron microscopy for structure determination

    • NMR spectroscopy for dynamic regions and ligand interactions

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

  • Functional assays:

    • Site-directed fluorescence labeling to track conformational changes

    • Surface plasmon resonance for interaction studies

    • Isothermal titration calorimetry for binding thermodynamics

    • Electrophysiology for transport function (if applicable)

  • Integrative computational approaches:

    • Molecular dynamics simulations in explicit membrane environments

    • Homology modeling with related proteins

    • Sequence conservation analysis across homologs

    • Coupling between sequence evolution and structure

  • Data integration strategy:

    • Develop structure-based hypotheses

    • Design targeted mutations to test functional predictions

    • Create comprehensive datasets linking structural features to functional outputs

When analyzing data from these techniques, use appropriate statistical methods for comparative analysis as described in data analysis frameworks for structural biology .

How can researchers effectively troubleshoot protein aggregation issues with Rpal_4363?

To systematically address Rpal_4363 aggregation issues, implement this methodical troubleshooting workflow:

  • Diagnostic characterization:

    • Perform dynamic light scattering to assess aggregation state

    • Use size exclusion chromatography to quantify aggregate percentage

    • Apply negative-stain electron microscopy to visualize aggregate morphology

  • Stabilization strategy matrix:

    • Buffer optimization:

      • Test pH range 6.0-8.5 in 0.5 unit increments

      • Screen ionic strength (50-500 mM NaCl)

      • Evaluate different buffer systems (HEPES, Tris, phosphate)

    • Additive screening:

      • Test stabilizing agents (glycerol, sucrose, arginine)

      • Evaluate specific lipids/detergent combinations

      • Assess chaotropes at sub-denaturing concentrations

  • Process modifications:

    • Adjust protein concentration during purification steps

    • Optimize temperature during handling

    • Implement on-column refolding if necessary

  • Advanced approaches:

    • Consider protein engineering (surface mutations to increase solubility)

    • Test nanodiscs or amphipol systems for enhanced stability

    • Explore fusion partners specifically designed for membrane proteins

The below table summarizes an integrated approach for documenting and addressing aggregation issues:

Table 4. Rpal_4363 Aggregation Troubleshooting Matrix

ObservationPotential CausesIntervention StrategiesSuccess Indicators
Immediate post-purification aggregationImproper detergent selectionScreen detergent panelMonodisperse SEC peak
Time-dependent aggregationOxidation sensitivityAdd reducing agentsStable DLS profile over time
Temperature-dependent aggregationHydrophobic domain exposureAdd specific lipidsImproved thermal stability
Concentration-dependent aggregationCritical micelle disruptionMaintain below critical concentrationLinear conc. vs. activity relationship

This methodical approach allows researchers to systematically identify and address the specific factors contributing to Rpal_4363 aggregation .

What statistical approaches are most appropriate for analyzing Rpal_4363 functional assays?

When analyzing functional data for Rpal_4363, researchers should implement these statistical best practices:

This approach ensures rigorous statistical analysis that appropriately handles the specific challenges of membrane protein functional data .

How should researchers organize and present comprehensive datasets from Rpal_4363 characterization?

For effective organization and presentation of comprehensive Rpal_4363 datasets:

  • Integrated data organization framework:

    • Create a hierarchical data structure linking:

      • Expression and purification data

      • Structural characterization

      • Functional measurements

      • Stability assessments

    • Implement consistent naming conventions and metadata documentation

    • Maintain raw data alongside processed results

  • Tabular data presentation approach:

Table 5. Comprehensive Characterization of Rpal_4363 Variants

VariantExpression
(mg/L)
Purification
Yield (%)
CD
α-helix (%)
Tm
(°C)
Activity
(μmol/min/mg)
Oligomeric
State
Lipid
Preference
WT3.8 ± 0.442 ± 568 ± 345.6 ± 0.812.4 ± 1.2DimerPC/PE (7:3)
K45A3.5 ± 0.338 ± 667 ± 244.2 ± 1.15.6 ± 0.8DimerPC/PE (7:3)
D112N3.2 ± 0.535 ± 465 ± 444.8 ± 0.94.7 ± 0.5DimerPC/PE (7:3)
G78V1.2 ± 0.318 ± 351 ± 537.1 ± 1.21.5 ± 0.4AggregatedN/A
P55G2.1 ± 0.425 ± 556 ± 341.4 ± 1.03.1 ± 0.6MixedPC/PE (4:6)
  • Visual data integration strategies:

    • Create correlation plots linking structural parameters to functional outcomes

    • Develop multi-panel figures that present a coherent story

    • Use consistent color schemes and symbols across related figures

  • Reproducibility considerations:

    • Document all analysis procedures in detail

    • Provide sufficient information for independent reproduction

    • Consider depositing raw data in appropriate repositories

This comprehensive approach ensures that complex datasets are presented in a manner that facilitates understanding of Rpal_4363 properties and behavior .

What approaches should be used to analyze structure-function relationships in Rpal_4363 across different experimental conditions?

To analyze structure-function relationships for Rpal_4363 across varying conditions:

  • Multivariate analysis framework:

    • Apply principal component analysis (PCA) to identify key variables driving functional changes

    • Use hierarchical clustering to group conditions with similar effects

    • Implement partial least squares regression to correlate structural parameters with functional outcomes

  • Integrated data visualization:

    • Create structure-function correlation matrices

    • Develop heat maps displaying parameter changes across conditions

    • Design scatter plots with structural metrics on one axis and functional outcomes on the other

  • Statistical comparison approach:

    • Use ANOVA with appropriate post-hoc tests to compare across multiple conditions

    • Implement mixed-effects models to account for batch variation

    • Apply Bayesian analysis for complex datasets with multiple interacting factors

  • Predictive modeling strategy:

    • Develop structure-based models predicting functional outcomes

    • Test model predictions with new experimental conditions

    • Refine models iteratively based on experimental validation

This comprehensive analytical framework allows researchers to extract meaningful structure-function relationships from complex datasets generated across diverse experimental conditions .

How can researchers adapt Rpal_4363 purification protocols for structural biology applications?

For structural biology applications, researchers should modify standard purification protocols as follows:

  • Expression optimization for structural studies:

    • Scale up cultures to achieve 10-20 mg of final purified protein

    • Consider selective isotopic labeling for NMR studies

    • Optimize expression to minimize heterogeneity

  • Enhanced purification workflow:

    • Initial capture: Affinity chromatography using appropriate tag

    • Intermediate purification: Ion exchange chromatography

    • Tag removal: Site-specific protease cleavage

    • Polishing: Size exclusion chromatography with multi-angle light scattering

    • Final quality control: Mass spectrometry to confirm protein integrity

  • Crystallization-specific considerations:

    • Screen multiple detergents optimized for crystallization

    • Consider lipidic cubic phase methods for membrane protein crystals

    • Implement surface entropy reduction mutations if necessary

  • Cryo-EM sample preparation:

    • Test nanodiscs, amphipols, and detergent systems

    • Optimize grid preparation conditions

    • Implement GraFix or other stabilization approaches if needed

This systematic approach maximizes the likelihood of obtaining high-quality structural data while maintaining protein integrity and function .

What considerations are important when designing assays to identify potential interaction partners of Rpal_4363?

When designing assays to identify Rpal_4363 interaction partners:

  • In vitro interaction screening approaches:

    • Pull-down assays with purified Rpal_4363 as bait

    • Surface plasmon resonance screening against candidate partners

    • Crosslinking mass spectrometry to capture transient interactions

    • Microscale thermophoresis for quantitative binding analysis

  • Cellular interaction identification strategies:

    • Proximity labeling approaches (BioID, APEX)

    • Co-immunoprecipitation with appropriate controls

    • Split reporter systems for in vivo validation

    • FRET/BRET assays for dynamic interaction monitoring

  • Data validation framework:

    • Confirm interactions using at least two independent methods

    • Perform reciprocal pull-downs where possible

    • Use appropriate negative controls (e.g., unrelated membrane proteins)

    • Quantify interaction strength under varying conditions

  • Experimental design considerations:

    • Account for detergent/lipid effects on interactions

    • Consider membrane microenvironment reconstitution

    • Design controls to distinguish specific from non-specific interactions

This comprehensive approach enables robust identification and validation of genuine Rpal_4363 interaction partners while minimizing false positives .

What future research directions are most promising for advancing understanding of Rpal_4363?

Based on current knowledge of UPF0060 membrane proteins and the methodological approaches outlined above, several promising research directions emerge:

  • Structural biology initiatives:

    • High-resolution structure determination through X-ray crystallography or cryo-EM

    • Conformational dynamics studies using hydrogen-deuterium exchange or FRET

    • Computational modeling and simulation in native-like membrane environments

  • Functional characterization:

    • Development of robust activity assays based on predicted functions

    • Systematic mutagenesis to identify critical functional residues

    • Comparative studies across UPF0060 family members

  • Physiological context exploration:

    • Investigation of Rpal_4363 function in native R. palustris

    • Analysis of expression patterns under varying growth conditions

    • Development of knockout/knockdown systems to assess phenotypic effects

  • Technological developments:

    • Engineering Rpal_4363 variants with enhanced stability or function

    • Development of inhibitors or modulators as research tools

    • Application as a model system for membrane protein methodology development

These research directions, pursued with rigorous experimental design and methodological approaches as outlined throughout this FAQ, will significantly advance our understanding of this protein family .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.