Recombinant Rhodopseudomonas palustris UPF0283 membrane protein RPA1583 (RPA1583)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RPA1583; UPF0283 membrane protein RPA1583
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Target Names
RPA1583
Target Protein Sequence
MTERVPPRRPATFKLSDPSVVLIDSDDGGGSYTAKPSAKADARPAASAAGAAPPPPPPRA RVELAREAEPPISAPKAPKSVINPKKGFRWGTVFWSAATGLVSLAFWLWISKLVEDLFAQ SQTLGTIGMVLALLAGGSLAIIIGREAFGLIRLARIEQLHARAARVLETDNSAEARAIIR ELLKFEHPNPQLAHGRATLQKHIDDIIDGADLIRLAERELMAQLDLEAKVLISKAAQRVS LVTAISPKALIDVLFVAIAATRLIGQLARLYGGRPGALGMFKLMRQTVSHLAITGGIALS DSVMQSVLGHGLASRLSAKLGEGVVNGMLTARLGLAAMDLTRPLPFDALPRPQLGDLVKD LMKKREKDE
Uniprot No.

Target Background

Database Links

KEGG: rpa:RPA1583

STRING: 258594.RPA1583

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant RPA1583 protein?

Methodological protocol for E. coli expression:

  • Clone the RPA1583 gene into an expression vector containing an N-terminal His-tag

  • Transform into E. coli BL21(DE3) or specialized membrane protein expression strains

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Induce with 0.1-0.5 mM IPTG

  • Shift temperature to 18°C and continue expression for 16-20 hours

  • Harvest cells by centrifugation at 5000×g for 15 minutes

  • Proceed with membrane preparation and protein purification

What are the optimal conditions for storage and stability of purified RPA1583 protein?

Optimizing storage conditions is critical for maintaining the structural integrity and functionality of membrane proteins like RPA1583. Based on product information and standard membrane protein handling protocols:

Storage ConditionRecommended ParametersNotes
Short-term storage4°C, up to one weekIn Tris-based buffer with 50% glycerol
Medium-term storage-20°CAliquot to avoid freeze-thaw cycles
Long-term storage-80°CTris/PBS-based buffer with 6% trehalose, pH 8.0
LyophilizationFreeze-dried powderReconstitute in deionized sterile water to 0.1-1.0 mg/mL

The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a cryoprotectant (50% final concentration is commonly used) . Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and aggregation .

Methodological approach for stability assessment:

  • Monitor protein stability at different temperatures using dynamic light scattering

  • Evaluate functional properties after storage at various time points

  • Determine aggregation propensity using size exclusion chromatography

  • Test different buffer compositions to optimize stability conditions

What analytical techniques are most suitable for characterizing RPA1583?

Several analytical techniques are particularly useful for characterizing membrane proteins like RPA1583:

TechniqueApplicationInformation Obtained
SDS-PAGEPurity assessmentMolecular weight, approximate purity (>90% recommended)
Western blottingProtein detectionIdentification via antibody recognition, expression level
Circular dichroism (CD)Secondary structureα-helical content, structural integrity
Dynamic light scattering (DLS)Size distributionHomogeneity, aggregation state
Mass spectrometryProtein identificationPrecise molecular weight, post-translational modifications
ELISAQuantitative detectionConcentration in complex samples

For experimental characterization of membrane proteins like RPA1583, a combination of detergent-based extraction methods followed by chromatographic purification is typically employed. Structural studies may require reconstitution into lipid nanodiscs or liposomes to maintain the native membrane environment .

What is the predicted membrane topology of RPA1583 and how can it be experimentally verified?

Based on sequence analysis, RPA1583 is predicted to have multiple transmembrane domains with both cytoplasmic and periplasmic regions. The hydrophobic regions suggest a complex topology that requires experimental validation:

Predicted FeatureApproximate Residue PositionPrediction Tool
Transmembrane helix 173-93TMHMM
Transmembrane helix 2103-123TMHMM
Transmembrane helix 3238-258TMHMM
Transmembrane helix 4298-318TMHMM
Cytoplasmic loop124-237Topology prediction
Periplasmic regions94-102, 259-297Topology prediction

Methodological approach for topology verification:

  • Cysteine scanning mutagenesis:

    • Introduce single cysteine residues at predicted loop regions

    • Label with membrane-impermeable sulfhydryl reagents

    • Analyze accessibility pattern to deduce topology

  • GFP-fusion analysis:

    • Create fusion constructs with GFP at different C-terminal truncation points

    • Express in R. palustris or E. coli

    • Assess fluorescence to determine GFP folding, which occurs only in cytoplasm

  • Protease protection assay:

    • Prepare inside-out and right-side-out membrane vesicles

    • Treat with proteases like trypsin

    • Identify protected fragments by mass spectrometry to map topology

  • Antibody accessibility experiments:

    • Generate antibodies against specific domains

    • Determine accessibility in intact cells versus permeabilized cells

    • Map extracellular versus intracellular domains

This multi-faceted approach allows for robust validation of protein topology predictions .

What genetic and molecular tools are available for studying RPA1583 function in Rhodopseudomonas palustris?

R. palustris has several genetic tools available for functional studies of proteins like RPA1583:

Genetic ToolApplicationAdvantagesLimitations
Suicide plasmid pJQ200SKGene deletionClean deletions, counter-selectable markerTime-consuming process
pMG103/pMG105 shuttle vectorsGene expressionStable maintenance in R. palustrisLimited inducible control
pBBR1MCS series plasmidsGene expressionMultiple antibiotic selection markersLower copy number
TargeTron Gene Knockout SystemGene disruptionSite-specific integrationLimited efficiency in R. palustris

Methodological approach for gene knockout studies:

  • Design and construct deletion plasmid with 1 kb flanking regions of RPA1583

  • Integrate onto R. palustris chromosome through homologous recombination

  • Select for first crossover events using gentamicin resistance

  • Counter-select for second crossover events using sucrose sensitivity

  • Verify deletion by PCR and phenotypic analysis

For complementation studies, the RPA1583 gene can be cloned into the pSRK-Gm vector under an IPTG-inducible promoter, allowing controlled expression in the knockout strain . Recent developments in CRISPR/Cas9-based genome editing tools for related purple nonsulfur bacteria suggest potential application in R. palustris as well .

What is known about the physiological role of RPA1583 in Rhodopseudomonas palustris metabolism?

While the specific function of RPA1583 remains to be fully elucidated, contextual evidence from R. palustris research suggests several potential roles:

Metabolic ContextPotential RoleEvidence Base
Membrane integrityStructural componentPredicted transmembrane domains, membrane localization
Photosynthetic apparatusAuxiliary componentCo-regulation with photosynthesis genes
Metabolite transportTransporter or channelSimilarities to other membrane transporters
Stress responseEnvironmental adaptationExpression changes under stress conditions

R. palustris is known for its extraordinary metabolic versatility, including photoautotrophic, photoheterotrophic, and chemoheterotrophic growth capabilities . The bacterium can utilize diverse carbon sources, including lignin-derived aromatic compounds . Since membrane proteins often play critical roles in environmental adaptation, RPA1583 may be involved in one of these metabolic pathways.

Methodological approach for functional characterization:

  • Comparative transcriptomics:

    • Analyze gene expression under different growth conditions (aerobic/anaerobic, different carbon sources)

    • Identify co-regulated genes to infer functional relationships

  • Metabolomic profiling:

    • Compare metabolite profiles between wild-type and RPA1583 knockout strains

    • Identify metabolic pathways affected by RPA1583 deletion

  • Growth phenotype analysis:

    • Test growth under various conditions (different carbon sources, pH, temperature)

    • Measure growth rates, lag phases, and maximum OD values

  • Membrane integrity assays:

    • Challenge cells with membrane stressors (EDTA, bile salts)

    • Quantify survival rates and membrane permeability changes

How does RPA1583 compare structurally and functionally to other UPF0283 family proteins?

The UPF0283 protein family (Uncharacterized Protein Family 0283) includes membrane proteins from various bacterial species. Comparative analysis reveals:

ParameterRPA1583UPF0283 Family AverageNotable Variations
Length369 amino acids350-400 amino acidsSome members have shorter N-terminal regions
Transmembrane domains4 predicted3-5 typicallyConservation in central domains
Conserved motifsGxxxG motifGxxxG commonDifferences in C-terminal sequences
Genomic contextPhotosynthetic gene clustersVarious metabolic clustersContext-dependent conservation

Methodological approach for comparative analysis:

  • Phylogenetic analysis:

    • Construct multiple sequence alignments of UPF0283 family proteins

    • Build phylogenetic trees to infer evolutionary relationships

    • Identify conserved regions suggesting functional importance

  • Structure prediction:

    • Use AlphaFold or similar tools to predict 3D structures

    • Compare predicted structural features across family members

    • Identify potential ligand-binding sites or functional domains

  • Genomic context analysis:

    • Examine neighboring genes for functional associations

    • Identify conserved gene clusters across multiple species

    • Infer potential functions from genomic organization

This comparative approach can provide insights into potential functional roles based on evolutionary conservation patterns .

What experimental approaches can determine protein-protein interactions involving RPA1583?

Identifying protein-protein interactions is critical for understanding the functional context of RPA1583:

TechniqueApplicationAdvantagesLimitations
Bacterial two-hybridIn vivo interaction screeningWorks for membrane proteinsPotential false positives
Co-immunoprecipitationPhysical interaction verificationCaptures native complexesRequires specific antibodies
Cross-linking mass spectrometryInteraction site mappingIdentifies interaction interfacesComplex data analysis
FRET/BRETDynamic interactions in vivoReal-time monitoring possibleRequires fluorescent tagging
Pull-down assaysDirect binding partnersCan use purified proteinsMay miss weak interactions

Methodological protocol for membrane protein interaction studies:

  • Chemical cross-linking coupled with mass spectrometry:

    • Isolate membrane fractions from R. palustris

    • Treat with membrane-permeable cross-linkers (DSS, BS3)

    • Digest proteins and analyze by LC-MS/MS

    • Identify cross-linked peptides to map interaction partners and interfaces

  • Proximity-dependent biotin labeling (BioID):

    • Create fusion of RPA1583 with BirA* biotin ligase

    • Express in R. palustris cells

    • Supply biotin to label proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

These approaches can reveal the protein interaction network of RPA1583, providing functional insights and suggesting potential roles in metabolic pathways or membrane processes .

How can structural studies of RPA1583 be optimized for membrane protein crystallography or cryo-EM analysis?

Structural determination of membrane proteins presents unique challenges:

Structural MethodSample RequirementsAdvantagesOptimization Strategies
X-ray crystallographyWell-diffracting crystalsHigh resolution possibleLCP crystallization, antibody fragments to enhance crystal contacts
Cryo-EMHomogeneous, stable sampleWorks for larger complexesGraFix method, amphipol stabilization
NMR spectroscopyIsotope-labeled proteinDynamic informationSelective labeling, detergent optimization
AlphaFold predictionSequence informationNo experimental sample neededRefinement with sparse experimental constraints

Methodological approach for RPA1583 structural studies:

  • Detergent screening:

    • Systematically test different detergents (DDM, LMNG, etc.)

    • Assess protein stability by size-exclusion chromatography

    • Identify conditions that maintain monodispersity

  • Lipid cubic phase (LCP) crystallization:

    • Reconstitute purified RPA1583 in monoolein LCP

    • Set up crystallization trials with various precipitants

    • Optimize crystal growth conditions (temperature, additives)

  • Cryo-EM sample preparation:

    • Stabilize protein in amphipols or nanodiscs

    • Optimize grid preparation (blotting conditions, support films)

    • Collect high-resolution data on latest generation microscopes

  • Hybrid approach:

    • Generate initial models using AlphaFold

    • Validate and refine with low-resolution experimental data

    • Use molecular replacement for crystallographic phase determination

This multi-faceted approach increases the chances of successful structural determination for challenging membrane proteins like RPA1583 .

How can RPA1583 be integrated into synthetic biology applications leveraging R. palustris capabilities?

R. palustris has significant potential for biotechnological applications due to its metabolic versatility:

ApplicationPotential Role of RPA1583Implementation Strategy
BioremediationMembrane transport of toxinsEngineering enhanced uptake capabilities
Biofuel productionEfflux of produced compoundsCo-expression with biofuel synthesis genes
CO2 fixationMembrane integrity under stressEngineered expression for extreme conditions
BiosensorsSignal transduction componentFusion with reporter systems

Methodological approach for synthetic biology applications:

  • Promoter engineering:

    • Characterize inducible/constitutive promoters in R. palustris

    • Develop tunable expression systems for RPA1583

    • Optimize expression levels for specific applications

  • Protein engineering:

    • Create chimeric proteins with functional domains

    • Enhance stability or specificity through directed evolution

    • Introduce novel functionalities via domain swapping

  • Metabolic pathway optimization:

    • Integrate RPA1583 expression with relevant metabolic pathways

    • Balance expression levels to avoid metabolic burden

    • Monitor effects on cell growth and product formation

Synthetic biology applications could leverage R. palustris' ability to grow on lignin-derived compounds and its photosynthetic capabilities, potentially using RPA1583 as a component in engineered membrane systems .

What role might RPA1583 play in the stress response and environmental adaptation of R. palustris?

R. palustris thrives in diverse environments, suggesting sophisticated stress response mechanisms:

Environmental StressPotential Role of RPA1583Experimental Approach
pH fluctuationsMembrane integrity maintenanceGrowth studies at various pH values
Temperature variationsMembrane fluidity regulationThermal stability assays
Oxygen level changesSupport for metabolic switchingTranscriptomics under aerobic/anaerobic conditions
Nutrient limitationTransport or signalingGrowth with limited carbon or nitrogen

Methodological approach for stress response studies:

  • Comparative growth analysis:

    • Expose wild-type and RPA1583 knockout strains to stress conditions

    • Monitor growth parameters (lag phase, growth rate, final OD)

    • Quantify survival rates after acute stress exposure

  • Membrane integrity assays:

    • Challenge cells with EDTA (outer membrane disruption)

    • Test with bile salts (membrane solubilization)

    • Measure leakage of cellular components

    • Quantify colony-forming units after exposure

  • Transcriptomic response:

    • Analyze gene expression changes under stress conditions

    • Compare wild-type and mutant transcriptional profiles

    • Identify co-regulated gene networks

Understanding RPA1583's role in stress response could provide insights into R. palustris' remarkable environmental adaptability and inform biotechnological applications under harsh conditions .

How do post-translational modifications affect RPA1583 function and localization?

Membrane proteins often undergo post-translational modifications (PTMs) that regulate their function:

Potential PTMFunctional ImpactDetection Method
PhosphorylationActivity regulationPhosphoproteomics, Pro-Q Diamond staining
Lipid modificationMembrane anchoringMass spectrometry with targeted extraction
GlycosylationStability, recognitionGlycoprotein staining, lectin affinity
Proteolytic processingActivation/inactivationN-terminal sequencing, mass spectrometry

Methodological approach for PTM analysis:

  • Phosphorylation site mapping:

    • Enrich phosphopeptides using TiO2 or IMAC

    • Analyze by LC-MS/MS with neutral loss scanning

    • Confirm sites by site-directed mutagenesis

    • Assess functional impact of phosphomimetic mutations

  • Global PTM profiling:

    • Purify RPA1583 under native conditions

    • Perform top-down proteomics to maintain intact modifications

    • Map modifications to specific domains

    • Correlate with functional states under different conditions

  • In vivo modification dynamics:

    • Monitor PTM patterns under different growth conditions

    • Correlate changes with functional outcomes

    • Identify regulatory enzymes responsible for modifications

Understanding PTMs could provide insights into regulatory mechanisms controlling RPA1583 function in response to environmental or metabolic changes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.